KEGG   Glycine max (soybean): 100808086Help
Entry
100808086         CDS       T01710                                 

Definition
uroporphyrinogen-III synthase, chloroplastic-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gmx  Glycine max (soybean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100808086
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100808086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 300 aa AA seqDB search
MPHFSLSPLSCAPSPLPPRRRIFLAPPRTAASSATDAASSSTSSSASNFAPKVVVTRERG
KNAKLIAALAKHEINCLELPLIEHIQGPDLGRLPSVLGDNAFDWVVITSPEAGSVFLEAW
RSSGMPHVKIGVVGAGTASIFKEALQSSNRSIDIAFVPSKATGKVLATELPKIGNKCTVL
YPASAKASNEIEEGLSNRGFEVTRMNTYTTVPVQHVDHTVLKIALAAPVVTVASPSSIRA
WKNLLSDSEWNNSVACIGETTATMARSLGFTNVYYPAQPGIEGWVESILEALGSYDELLR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgccccatttttctctctcccctctctcctgtgcaccttctcctctcccacctcgccgc
cgaatctttctcgctcctccccgaaccgccgcatcttccgccaccgacgccgcttcctct
tctacttcctcttccgcttcgaatttcgctcccaaagtcgtcgtcaccagagagcgcggc
aagaacgccaagcttatcgccgctctggctaaacatgaaatcaattgtttggagcttcct
ctcattgagcacattcaaggacctgatttaggcaggcttccttctgtattaggtgacaat
gcatttgattgggttgtgataacgtctccagaggcaggttctgtctttctagaggcatgg
agatcttctgggatgcctcatgtcaaaataggtgttgttggggctggtactgcaagcatt
ttcaaggaagctttgcagtcttcaaaccgatcaattgatattgcctttgtgccatcaaaa
gcaacaggaaaggttttggctactgagcttcctaagattggaaataaatgcaccgttctc
tatcctgcttctgcaaaggctagcaatgagattgaggaaggactttcaaaccgtggattt
gaggttactaggatgaatacatatacaacggtgccagttcaacatgttgaccatacggtt
ctaaagatagcacttgctgcccctgttgttacagtagcttcaccatcttctattcgtgcc
tggaagaatcttctttcagattctgagtggaacaattctgttgcatgcattggtgagaca
actgctacaatggcaagaagtttaggtttcacaaatgtgtactatccagcacaaccaggc
atcgaaggctgggtagaaagcattcttgaagcattaggttcctatgatgaattattgagg
tag

DBGET integrated database retrieval system