KEGG   Glycine max (soybean): 100808523Help
Entry
100808523         CDS       T01710                                 

Definition
probable glutathione peroxidase 8-like
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gmx  Glycine max (soybean)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100808523
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100808523
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100808523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 167 aa AA seqDB search
MATNHSKSVFDFTVKDAKGDDVDLATYKGKVLLIVNVASKCGMTNSNYVELNQLFEKYKD
KGLEILAFPCNQFGEEEPGSNDQIQEFVCTRFKSEFPIFDKIEVNGDSACPLYKFLKSGK
WGIFGDDIQWNFAKFLIDKDGQVVDRYYPTTSPLSLERDIRKLIGIV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaccattcaaagtccgtctttgattttactgtcaaggatgctaaaggcgat
gatgtggatcttgctacttacaagggaaaagtcttgctgattgttaatgttgcttccaaa
tgtggcatgaccaactcaaattatgtggagttgaatcaactattcgagaaatacaaagac
aaagggctggagattctggcatttccatgtaatcaatttggtgaggaggaacccggaagc
aatgatcaaattcaggagtttgtctgcactcgctttaaatctgaatttcccatctttgat
aagattgaagtgaatggagacagtgcttgtcctttgtataagttcttaaagtcaggcaag
tggggaatctttggggatgatattcagtggaactttgccaaattcttgattgacaaggat
gggcaagtggtagatcgctattatcccaccacatctcctcttagccttgagcgagacatc
cgtaagttaattggtattgtctga

DBGET integrated database retrieval system