KEGG   Glycine max (soybean): 100808892Help
Entry
100808892         CDS       T01710                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial-like
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
gmx  Glycine max (soybean)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gmx01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gmx00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:gmx00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:gmx00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 407 aa AA seqDB search
MQRFKALLPQQTRSSLRTLCSHRRAFSAQPNYAKHHDDDSQEQILVEGRAKSRAAILNRP
SSLNSLNASMVARLKRLYDSWEENSDIGFVLMKGSGRAFCSGADVVRLYHSLNEGNTDEA
EQFFKTLYSFVYLQGTYLKPHVAILDGITMGCGSGISLPGMFRVVTDKTVFSHPEAQIGF
HPDAGASYVLSRLPGYLGEYLALTGDKLNGVEMIACRLATHYSLNARLSLLEERLGKLIT
DEPSVVESSLAQYGDLVYPDRSSVLHRIDTIDRCFSHETVEEIIEALEKEAAESNDEWYS
TTLRRIREASPLSLKVTLQSIREGRFETLDKCLVREYRMSLRGISEHVSSDFFEGVRARM
VDRDFAPKWDPPRLKDISEDMVEYYFSPLSEVQSELVLPTALREPYM
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcagagattcaaagctctgctacctcaacaaactaggtcctcacttcgcactctctgt
tctcaccgtcgagctttctccgctcaaccgaattacgcaaagcaccacgacgacgattct
caggaacagattttagtcgaaggaagagcgaaatcacgagcagctattctcaacaggccg
tcttcgctgaactcgctcaatgcttcaatggttgctcggttgaagaggctgtatgactcc
tgggaagaaaactctgatattggctttgttttgatgaagggtagtggcagagctttctgt
tctggtgcagatgttgttaggctgtatcactcactcaatgaaggaaatactgacgaagct
gaacagtttttcaaaacattatattcatttgtatatcttcaagggacatatcttaaacca
catgttgccattttggatggaataacaatggggtgtggatctggaatttctctaccagga
atgttccgtgtggtaactgataaaactgttttttctcacccagaagctcaaataggtttc
cacccagatgcaggagcttcttatgttttgtctcgtctacctggctacttaggggaatac
ttggcccttacaggagataagcttaatggtgttgaaatgattgcctgccgccttgctact
cattattcactaaatgcaaggctctctttgcttgaagaacgtcttggtaaactaatcaca
gacgaaccttctgttgtggagtcatccctcgcacagtatggtgatcttgtttatccagat
aggagcagtgtccttcacaggattgatactattgatagatgtttcagtcacgaaactgtg
gaggaaattattgaagctttggagaaagaggctgctgagtctaatgacgaatggtactcg
actactctaaggagaataagagaagcctccccgttgagtttgaaagttactttacaatct
atacgtgaaggtagatttgaaacacttgataaatgtcttgtacgtgagtatcgcatgtcc
ctacgtggtatttcagagcatgtctcctctgatttctttgagggtgttcgggcacgaatg
gttgatagagattttgcaccaaagtgggacccacctagattaaaagatatatcagaggac
atggttgaatactatttctctcctttaagtgaagttcaatctgaattagtgctgccaaca
gctttgcgagaaccttacatgtga

DBGET integrated database retrieval system