KEGG   Glycine max (soybean): 100808892Help
Entry
100808892         CDS       T01710                                 

Definition
(RefSeq) 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial-like
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00280  Valine, leucine and isoleucine degradation
gmx00410  beta-Alanine metabolism
gmx00640  Propanoate metabolism
gmx01100  Metabolic pathways
gmx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100808892
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100808892
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100808892
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     100808892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 EutC
Motif
Other DBs
NCBI-GeneID: 100808892
NCBI-ProteinID: NP_001242643
UniProt: C6T7J7
Position
17
AA seq 407 aa AA seqDB search
MQRFKALLPQQTRSSLRTLCSHRRAFSAQPNYAKHHDDDSQEQILVEGRAKSRAAILNRP
SSLNSLNASMVARLKRLYDSWEENSDIGFVLMKGSGRAFCSGADVVRLYHSLNEGNTDEA
EQFFKTLYSFVYLQGTYLKPHVAILDGITMGCGSGISLPGMFRVVTDKTVFSHPEAQIGF
HPDAGASYVLSRLPGYLGEYLALTGDKLNGVEMIACRLATHYSLNARLSLLEERLGKLIT
DEPSVVESSLAQYGDLVYPDRSSVLHRIDTIDRCFSHETVEEIIEALEKEAAESNDEWYS
TTLRRIREASPLSLKVTLQSIREGRFETLDKCLVREYRMSLRGISEHVSSDFFEGVRARM
VDRDFAPKWDPPRLKDISEDMVEYYFSPLSEVQSELVLPTALREPYM
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcagagattcaaagctctgctacctcaacaaactaggtcctcacttcgcactctctgt
tctcaccgtcgagctttctccgctcaaccgaattacgcaaagcaccacgacgacgattct
caggaacagattttagtcgaaggaagagcgaaatcacgagcagctattctcaacaggccg
tcttcgctgaactcgctcaatgcttcaatggttgctcggttgaagaggctgtatgactcc
tgggaagaaaactctgatattggctttgttttgatgaagggtagtggcagagctttctgt
tctggtgcagatgttgttaggctgtatcactcactcaatgaaggaaatactgacgaagct
gaacagtttttcaaaacattatattcatttgtatatcttcaagggacatatcttaaacca
catgttgccattttggatggaataacaatggggtgtggatctggaatttctctaccagga
atgttccgtgtggtaactgataaaactgttttttctcacccagaagctcaaataggtttc
cacccagatgcaggagcttcttatgttttgtctcgtctacctggctacttaggggaatac
ttggcccttacaggagataagcttaatggtgttgaaatgattgcctgccgccttgctact
cattattcactaaatgcaaggctctctttgcttgaagaacgtcttggtaaactaatcaca
gacgaaccttctgttgtggagtcatccctcgcacagtatggtgatcttgtttatccagat
aggagcagtgtccttcacaggattgatactattgatagatgtttcagtcacgaaactgtg
gaggaaattattgaagctttggagaaagaggctgctgagtctaatgacgaatggtactcg
actactctaaggagaataagagaagcctccccgttgagtttgaaagttactttacaatct
atacgtgaaggtagatttgaaacacttgataaatgtcttgtacgtgagtatcgcatgtcc
ctacgtggtatttcagagcatgtctcctctgatttctttgagggtgttcgggcacgaatg
gttgatagagattttgcaccaaagtgggacccacctagattaaaagatatatcagaggac
atggttgaatactatttctctcctttaagtgaagttcaatctgaattagtgctgccaaca
gctttgcgagaaccttacatgtga

DBGET integrated database retrieval system