KEGG   Glycine max (soybean): 100808899Help
Entry
100808899         CDS       T01710                                 

Definition
(RefSeq) folate synthesis bifunctional protein, mitochondrial-like
  KO
K13941  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00790  Folate biosynthesis
gmx01100  Metabolic pathways
Module
gmx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100808899
Enzymes [BR:gmx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     100808899
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     100808899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_bind HPPK
Motif
Other DBs
NCBI-GeneID: 100808899
NCBI-ProteinID: XP_003518782
UniProt: K7K7V7
Position
2
AA seq 523 aa AA seqDB search
MGISKMSILKCLGEPRNKLFAARKYLEGLGFSSFHTASKSSVELHSQEEEVVIALGSNVG
DRLHNFKEALKLMRNSGINITRHACLYETAPAYVTDQPRFINSAVRAVTKLGPHELLSAL
KKIEKDLGRTGGIRYGPRPIDLDILFYGKYKVRSDILTIPHERIWERPFVMAPLMDLLGS
AIDSDTVASWHSFSGHSRGLTGLWEDLGSESLIGEFGKEGMYRVMPVANGLLDWSRRTSV
MGILNVTPDSFSDGGNFKSVESAVYQVRLMISEGADMIDIGAQSTRPTASRISAAEELGR
LIPVLEAVVSMPEVEGKLISVDTFYSEVASEAVSKGAHLINDVSAGQLDSNMFKVMADLD
VPYVAMHMRGDPSTMQNSENLKYGNVCKEISSELYSRVREAEMLGIPAWRIMIDPGIGFS
KKTEHNLDILMGLPDIREEIATRSLAISHAPMLIGPSRKRFLGEICSRPDAAKRDPSTIA
SVTAGVLGGANIVRVHNVKDNLDAVKVCDAILRQKSSHLKSRH
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgggtatttccaagatgagtattttgaagtgtctgggggagcccaggaataagcttttt
gctgccagaaagtatcttgaaggactgggtttttcctcttttcacacagcttcaaaatcc
tctgtggagcttcactcacaagaagaggaagtagtgattgctttgggaagtaatgtaggt
gacaggctgcataacttcaaggaagccctgaaattgatgaggaactcaggcattaacatc
acaagacatgcttgcttgtatgagacagcaccagcatatgttactgatcaacctcgcttt
atcaactcagcagttagagctgttactaaactcggtccacatgaactattgtctgcactc
aaaaaaattgagaaggacttgggccgtacaggtggtatacggtatggtccaaggccaatt
gacttagacattttattctatggtaaatataaagtcagatctgatatcctcactatacct
catgaaagaatttgggaaaggccatttgtgatggctcccttgatggacttattgggatca
gctattgacagtgacacagttgcttcctggcattcattttcaggccattctcgtggactc
actggattatgggaagatttagggagtgaatcacttattggagagtttggaaaggaagga
atgtatagggtaatgcctgttgcaaatggcttacttgactggtcgcggagaacttccgtc
atggggatccttaatgtgactccagatagttttagtgatgggggaaatttcaagtctgtg
gagtctgctgtttatcaggttcggttaatgatttcagaaggagcagatatgattgatatc
ggggctcagtctactcggccaacggcctctaggatctctgctgcagaagaattaggtaga
ttaatccctgtcctggaagctgtagtgtcaatgcctgaggtagaaggaaagctcatttct
gtggatactttctactctgaagttgcttcagaagcagtgagtaaaggggctcatcttata
aatgatgtatctgctggacagttggatagtaacatgtttaaagtcatggctgatcttgat
gttccttatgttgcaatgcacatgaggggggacccatctacaatgcagaatagtgaaaat
ctgaaatatggtaatgtttgtaaagagatatcatcagagctatactcgcgggttagagag
gcagagatgttaggaatcccagcatggaggattatgattgaccctggcattggattctca
aagaaaactgaacacaatttagacattctcatgggactacctgatatcagagaagagatt
gccacaagaagtttggccatctctcatgctcccatgcttattggaccctcaagaaagaga
tttttaggtgaaatttgctctcgtcccgacgcagccaagagggatccttctaccattgct
tcagtcacagctggtgttttgggaggggctaatattgttagggtgcataatgtcaaagat
aatctagatgctgtgaaggtttgtgatgcaatcctaagacagaaaagttctcacttgaaa
tctagacattag

DBGET integrated database retrieval system