KEGG   Glycine max (soybean): 100808905Help
Entry
100808905         CDS       T01710                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100808905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 473 aa AA seqDB search
MGQKQRSSSEADNEVKKRRRVGFSGVDSGVEAKDCITIYLVSSKEEFDAPESFVIHPVDL
NSFFDDDGKIYGYEGLKITIWISSISFYAYADITFQSSSDRGKGVTDLKSALQTIFAETL
VDSKDEFLQKYLADNDFVRTNISNGETLKHKAFKENICDSNQLTDSSTSTVEVVRLVAGN
MATGQLYSHLIPLTLLLVDGSSPIDVTDSQWELYIVCQKKTDQQGEIQYRLTGFTAVYRF
YHYPDDSRLRLSQILVLPPYQHKGYGRFLLEVLYDVAISENVFDFTVEEPLDHFQRVRTC
VDALRLLRFGPIQNIVTKAVSLLKQEKLSKKAHCPRLLPPPSAIEDVRKSLKINKQQFLQ
CWEVLIYIGLNPVDKNMENFVSIILNRVKYDILGKDSGTSGKQLIEVPSDVDQEMSFVMF
RSEANEASTVQMDDNQANQEEQLQKLVQERVKEIQLIAEKVTLHLGSSGLVVN
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaagcagcgttcaagttccgaagccgacaacgaagtcaagaaacgacgccgt
gttggtttctcaggcgttgattctggagttgaggccaaagactgcatcacaatctatcta
gtttcaagcaaggaggaattcgatgctccagagagttttgtcattcatcctgtggatctg
aatagcttttttgatgatgatgggaaaatttatggttatgagggtttgaagattaccatc
tggattagcagcatatcattttatgcgtatgctgatattacattccagagttcatctgat
cgaggcaaaggggtcacagatctgaaatctgctcttcagacaattttcgctgagactctt
gttgatagcaaggatgaattccttcagaaatatttggcagataatgactttgtcagaaca
aacatctcaaatggagaaactttgaagcacaaagcttttaaggagaacatttgtgattct
aaccagcttacagattcttctacttctactgttgaggttgtccgtttggtggctggcaac
atggctactggacaactttacagtcatctaatacccctcacactacttcttgttgatggt
agcagtccaattgatgttaccgattcacagtgggagctgtatattgtgtgtcagaagaaa
actgatcagcagggagagatccaatataggttgactggttttactgctgtttatcgattt
tatcactatcctgatgattcccgattgcgactaagccagatactggtattacctccttac
cagcacaagggttatggtcgattccttctagaggtgctatacgatgttgctatatctgaa
aatgtttttgacttcacagtagaagagccattagatcacttccaacgtgtccgcacatgt
gttgacgcacttcgcctgcttcgttttggcccaattcagaatatagttactaaagccgtt
tcacttctgaagcaagaaaagttatcaaagaaagcacattgtcctcgacttttaccacct
cccagtgctattgaggatgtaaggaaaagtctgaaaattaataagcaacagtttctccag
tgttgggaggttttgatctacattggccttaatcctgttgacaagaacatggagaacttt
gttagtattattttgaaccgtgttaagtatgatatcttagggaaagattctgggacgtct
gggaagcaacttattgaagtaccaagtgatgttgaccaggagatgtcatttgtcatgttc
agatcagaagctaacgaagctagtactgtgcaaatggatgacaatcaggctaatcaagaa
gagcaactccagaagttagttcaggaaagggtgaaagaaattcagttgattgcggaaaag
gtaaccctgcatcttgggagctcagggttggtggttaattag

DBGET integrated database retrieval system