KEGG   Glycine max (soybean): 100808939Help
Entry
100808939         CDS       T01710                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00620  Pyruvate metabolism
gmx00640  Propanoate metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100808939
   00620 Pyruvate metabolism
    100808939
   00640 Propanoate metabolism
    100808939
Enzymes [BR:gmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100808939
Lipid biosynthesis proteins [BR:gmx01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100808939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 100808939
NCBI-ProteinID: XP_003553322
UniProt: I1N846
Position
19
AA seq 752 aa AA seqDB search
MIPLSHNPVSVHLGGTPCDSLHPITFHPILNKPRSSASLFWNCKRRRKRKSSITMASNLR
TNNFLRHVESMKLLPSGAGHISHLNAVILGESLATEEDDFVLPSEDFASQANVQSPEQYL
KMYNRSIEDPAGFWSEIASEFYWKQRWGDKVCDENFDVRKGNIKIEWFKGGITNICYNCL
DRNVEAGLGDKVAIYWEGNEPGLDGTLTYTELLQQVCQLANYLKDIGVKKGDAVIIYLPM
LMELPIAMLACARIGAVHSVVFAGFSAEALSQRIIDCKPKVVITCNAVKRGPKPIYLKDI
VDAAINDSAQNGVSIDKCLVYENPLAMKRVDTKWKEGRDIWWQDVIPQYPTTCPLEWVDA
EDPLFLLYTSGSTGKPKGVLHTTGGYMVYTATTFKYAFDYKPSDIYWCTADCGWITGHSY
VTYGPMLNGASVIVYEGAPNYPDAGRCWDIVDKYKVTIFYTAPTLVRSLMRDGDAFVTRY
SRKSLRVLGSVGEPINPSAWRWFYNVVGDSRCPISDTWWQTETGGFMITPLPGAWPQKPG
SATFPFFGVQPVILDEKGVEIEGECNGYLCVKKSWPGAFRTLYGDHERYETTYFKPFAGY
YFSGDGCSRDKDGYHWLIGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGVEHEVK
GQGIYAFVTVVDGVPYSEELRKDLVLIVRKQIGAFAAPDKIHWAPGLPKTRSGKIMRRIL
RKIASRQLDELGDTSTLADPNVVNQLIELADS
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgattcctctgtcccataacccagtctctgttcacctgggtggaacaccctgtgactct
cttcacccaattacgttccatccaattctgaataagcctcgttcttctgcctctctgttt
tggaactgcaaaaggagaaggaagaggaaaagctccattactatggcttctaatctcaga
accaacaatttcctgcgccatgtggaatcaatgaagcttcttccatcaggtgcgggtcac
atttcacacttgaatgctgtgatacttggtgaatctctcgccactgaagaggatgatttc
gttcttccaagtgaggactttgctagccaagccaatgttcagtccccagaacagtatctg
aagatgtataatagatccattgaggatcctgctggattctggtctgagattgcctcagag
ttctattggaaacagagatggggtgataaagtgtgtgatgaaaattttgatgtgaggaaa
gggaatataaagattgagtggttcaagggtggcatcaccaacatctgttataattgcttg
gatagaaatgttgaagctggacttggtgacaaggttgccatttactgggaaggcaatgag
cctggtttggatggtactttgacatacactgaacttctacaacaagtttgccagcttgca
aactaccttaaagatattggtgtgaagaagggagatgccgtaattatttatttgcccatg
cttatggagcttcccatcgcaatgcttgcttgcgcccggattggtgctgttcattcggtt
gtatttgctggtttttctgcagaagctctttcccagagaatcattgattgtaaaccaaaa
gttgttattacttgcaatgctgttaaaaggggccctaagcctatctatctaaaagatatt
gttgatgctgcaatcaatgattcagcccaaaatggggtctctatagataaatgcctagtt
tatgaaaacccattggcaatgaagagggtagataccaaatggaaggaagggcgtgatata
tggtggcaggatgtcattcctcaatatccaactacttgtccgttggagtgggttgatgca
gaggatccactttttctactctatacaagtgggagcacaggaaaacctaagggtgtcctc
catacaactggtggttacatggtgtacactgcaacaacatttaagtatgcatttgactac
aagccgtctgacatctactggtgtacagctgattgtggttggattactgggcacagctat
gtcacttatggacccatgctcaatggtgcatctgttattgtgtatgaaggggctcctaat
tatcctgatgctgggagatgttgggacattgttgacaaatataaggtgacaatattctac
actgctccgacattggtgcggtctctcatgcgtgatggtgatgcgtttgttactcgctac
tcaaggaaatctttacgagtcctaggaagtgtaggtgagcccataaatccaagtgcatgg
aggtggttttacaatgtagttggagattcaaggtgccctatctctgacacttggtggcaa
acagaaacaggtggcttcatgataactccactaccaggtgcttggccccagaaacctggt
tctgcaactttccctttctttggagttcagcctgtcatactggatgagaaaggtgttgaa
atagaaggggagtgcaatggatatttgtgtgtgaagaaatcatggcctggggcattcaga
actctgtatggtgatcatgaaagatatgaaacaacatatttcaagccatttgccggatac
tatttcagtggtgatggttgcagcagggataaagatggataccattggctcattggaaga
gttgacgatgtcatcaatgttagtgggcatcgaattggcacggcagaagtggaatcagct
ttagtttcacatccgcaatgtgcagaggctgctgtggttggtgtggagcatgaggtcaaa
ggacagggcatctatgcatttgttacagttgtggatggtgttccttacagtgaagaactg
cggaaggaccttgtactcatagttcgaaagcagataggagcctttgcagcacctgataaa
attcattgggcacctggccttccaaaaacaaggagtggaaagataatgcgaagaattctg
agaaaaattgcgtctcggcagctggatgaacttggagatacaagtacccttgcagatcca
aatgtggtcaatcaacttatagaacttgcagattcttga

DBGET integrated database retrieval system