KEGG   Glycine max (soybean): 100809080Help
Entry
100809080         CDS       T01710                                 

Definition
(RefSeq) putative glucose-6-phosphate 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100809080
Enzymes [BR:gmx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     100809080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 100809080
NCBI-ProteinID: XP_003533724
UniProt: K7LC03
Position
9
AA seq 321 aa AA seqDB search
MSTEKEKTSSPSPSVELCKGFNGLEKVLLRESRGSSAEVYLYGGHVTSWKNDHGEELLFL
SNKAIFKPPKAIRGGIPLCFPQFGGLGTLDQHGFARNRFWTIDDDPPPFPTNTLSKAFVD
LILKPTEEDTKIWPHSFEFRLRIALGPGGDLMLTSRIRNTNSEGKPFSFTFAYHTYFSVS
DISEVRVEGLETLDYLDNLQNKERFTEQGDALTFESEVDKIYLSTPTKIAIIDHEKKRTF
VVRKDGLPDAVVWNPWDKKAKAMADFGDDEYKHMLCVEAAAIEKPITLKPGEEWKGRLEL
SAVPSSYRSGQLDPQRVLLGS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaaaaggagaaaacatcttcaccttctccttccgtcgagctctgcaagggc
ttcaatggcctcgagaaggttctcctccgcgaatcgcgtggttcctccgccgaggtgtat
ctgtacggtggccacgtgacttcttggaagaacgaccatggcgaggaattgctttttctc
agtaataaggctatatttaagcctccaaaggcaattcgtggagggattccactatgcttt
ccacaatttggaggccttggtaccctggaccagcatggatttgctagaaatcgattctgg
accattgatgatgaccctcctccttttccaacaaatactttgagcaaagcctttgttgat
ttgattcttaagcccactgaagaagacacgaagatttggcctcacagttttgagttccgt
cttaggatagctttgggaccaggaggagatctgatgctgacatcccggatcaggaacaca
aacagtgaggggaagccattttcgttcacctttgcatatcatacatatttctctgtatca
gacataagtgaagttcgggtagagggattggagaccctggattatcttgataacttgcag
aacaaggagcgctttactgaacagggggatgctttaacgtttgaatcagaagttgacaag
atatatcttagcactcccacaaagattgcaattattgatcatgaaaaaaagagaacattt
gttgtgcgtaaagatggccttcctgatgctgtggtgtggaatccttgggataagaaagca
aaggccatggctgattttggtgatgatgagtacaagcatatgctttgtgtagaggctgct
gctattgaaaagcctatcactttgaaacccggagaagaatggaaaggaaggttagagctt
tcagctgtgccctctagttatcgcagtggacaacttgatccccagagagttcttctggga
agctga

DBGET integrated database retrieval system