KEGG   Glycine max (soybean): 100809128Help
Entry
100809128         CDS       T01710                                 

Definition
4-alpha-glucanotransferase DPE2-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100809128
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     100809128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 965 aa AA seqDB search
MVNPGLFSANKSVNSVKVSFRIPYFTQWGQTLLVCGSVPVLGSWNVKKGVLLRPIHQGAE
LIWGGSITVPKGFRCQYSYYVVDDNKNVLRWEMGKKHELVLPEGIRSGHEIEFRDLWQTG
SDALPFRSAFKDVIFRQCWDLSDTTVGVNHINIEPEGEAILVQFKISCPNIEKDTSIYVI
GSNTKLGQWKVENGLKLSYFGESVWKSECVMQRSDFPIKYRYGKYDRCGNFSIESGPNRE
VSTNSSRSEAKYIFLSDGMMREIPWRGAGVAIPMFSIRSESDLGVGEFLDLKLLVDWAVA
TGFHLVQLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSKNIPEAIKKEIEKAK
QQLDGKDVDYEATMATKLSIAKKVFAQEKDLILNSSSFKEFFSENEGWLKPYAAFCFLRD
FFETSDRTQWGHFAHYSEDKLEKLVSKDSLHYEIICFHYYVQYHLHLQLSEAAEYARKKG
VILKGDLPIGVDRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNY
GWWRARLTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIPLSLEELEREGIW
DFNRLSRPYIKRELLQEKFGDAWTFVATTFLNEIDKNFYEFKEDCNTEKKIASKLKICAE
SSLLLESVDKLRHNLFDLSQNIVLIRDSEDPRKFYPRFNLEDTSSFQDLDDHSKNVLKRL
YNDYYFCRQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQR
MPNEPDLEFGIPSKYSYMTVCAPSCHDCSTLRAWWEEDEERRLRFFKNVMESDELPPDQC
VPEVVHFVLRQHFEAPSMWAIFPLQDLLALKEEYTTRPATEETINDPTNPKHYWRYRVHV
TLESLIKDNDLQTAIKDLVRWSGRSLPKEDDSEVEVSPVSALSSAEALSEKQQFAGTMEK
PVLVK
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatccaggattgttttctgcgaataagtctgtgaattcggtgaaagtaagcttt
cggataccgtattttacccaatggggtcagaccttgttggtgtgtggctctgttccagtg
cttggttcatggaatgtgaagaagggtgtgctgctcaggcccattcatcaaggggctgag
ctcatctggggtggaagcatcactgtgccaaaagggttccgatgccagtacagctattat
gttgtagatgataacaagaatgtgctgagatgggagatggggaagaagcatgaattggta
ctccctgaaggaattcggagtggccacgagattgagttccgtgatctttggcagactggc
tcagatgcactccctttcagaagtgctttcaaagatgtaatttttcggcaatgctgggat
ttgagtgacacaaccgtaggagtaaaccacattaatattgaaccggaaggagaagctatc
ttggtccaattcaaaatatcctgcccaaatattgagaaagacacatcaatatatgtcatt
ggtagcaatacaaagttggggcagtggaaagttgaaaatggactaaaactcagctatttt
ggtgaatctgtctggaaaagtgaatgcgtgatgcaaaggagtgatttccccataaaatat
agatatggcaaatatgacaggtgtggaaacttttctatagagagtggtccaaatcgagaa
gtctctactaactcctcaaggagtgaggcaaaatatatttttctttcagatggcatgatg
cgggaaataccttggcgtggtgctggcgtagcaatcccaatgttttctattaggtcggaa
tctgatctgggtgttggagagtttcttgaccttaagttgctagttgactgggctgtagca
actggtttccatttagttcaacttttaccaatcaatgatacatctgtgcatgggatgtgg
tgggattcttatccatacagttcactctcagtctttgccttgcatccattgtacctgaga
gtacaggcactttctaagaacatacccgaggcgatcaagaaagagattgaaaaggcaaag
cagcaactagatgggaaggatgttgattatgaggctacaatggctactaaactctcaatt
gctaagaaagtttttgctcaagagaaagatttgatacttaattcaagttcctttaaggag
ttcttttctgagaatgagggttggttgaaaccctatgctgctttctgtttcctgcgggac
ttctttgaaacatcagatcgcactcaatggggtcattttgctcattactcagaagataag
ctagagaaacttgtatccaaggacagcctgcattatgagataatttgcttccactactat
gttcaataccatttacatttacaattatcagaagctgcagaatatgcaagaaagaaggga
gtgatactaaagggagatcttcctattggggttgacagaaacagtgtggatacctgggtg
tatccaaatttgttccgaatgaacacttctactggggcacctccagattattttgataaa
aatggccagaattggggtttccctacatataattgggaagaaatgtcaaaggacaactat
ggttggtggagagctcgattaacacagatggcaaaatattttacagcttacaggattgat
cacatattgggattcttccgaatttgggaacttccggatcatgctgcgacaggtcttgtt
ggaaaattccgaccatctattcctcttagtctggaagaacttgaaagagaaggaatatgg
gactttaatcgcctaagtcgcccatatattaagcgggaattattgcaggaaaaatttggt
gatgcttggacttttgttgcaacaacttttctaaatgaaattgacaagaacttctatgag
ttcaaggaggattgcaacacagagaaaaaaatagcttccaaactgaaaatttgtgcagaa
agttctctattgttggagagtgtagacaaattgaggcacaatctctttgatctttcacag
aatatagttctaatccgagattcagaagatccaagaaaattttatcctcgtttcaacctt
gaagatacctcaagtttccaggatttggatgatcatagcaagaatgttctcaaaagatta
tacaatgactactatttctgtcgtcaagagaatctttggaggcaaaatgcattgaagacc
ctgcctgtacttctaaattcatcagacatgctagcctgtggggaagatttgggcctcatt
ccatcttgtgtccatcctgttatgcaagaactgggattagttgggttgcgcattcagcgc
atgcccaatgaacctgatctggaatttggtattccttctaagtacagctacatgacggta
tgtgccccttcatgtcatgactgttccaccttgcgtgcttggtgggaagaagatgaagaa
agaagactcaggtttttcaagaatgtgatggagtccgatgagttgccgcccgatcaatgt
gttccagaagttgtacattttgttctaagacagcattttgaagccccatcaatgtgggca
atcttccctcttcaggacttgttagcattgaaagaagaatatacaacacgccctgcaaca
gaggagacaatcaacgaccctacgaatccgaagcactattggagataccgtgtgcatgtg
actttggaatcactgatcaaagataatgacctccaaaccgccatcaaagatctcgtacgt
tggagtggaagatcactccctaaggaagacgactcagaagtagaagtgagcccagtgtcg
gcgttgtcatcagcagaagctctttctgagaagcagcagtttgccggtaccatggaaaag
cctgttcttgtcaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system