KEGG   Glycine max (soybean): 100809162Help
Entry
100809162         CDS       T01710                                 

Definition
OTU domain-containing protein 5-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100809162
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100809162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 519 aa AA seqDB search
MTRVLVQRGSSGGGSSSNPNRSGGGGGSSSNSSVRAEPQVPVLPENSDEVVVVSDEVLES
GDKGKSEEGVHFEQGDGSCEDDVAAVVVESDVREEIVKGLSGLRVGERVVSESEGSSGDS
SSLLVGGGSCPPPPPVPPPKPSVTGNLNSRRSVAGSLNSGSVGSSRRAVTWPIVSARTSP
AGSRPSSPRSHNESEGYNSADEQKPCLVSSYDDFERERQFEIDIRRAKGYEVKKMMEDGN
CLFRAVADQVYGDSEVYDLIRQMCIDYMERERDHFSQFITEGFTSYCKRKRRDKVYGNNV
EIQAMCEMYNRPIHIYSYTTEPINIFHGSYNTDMPPIRLSYHHGNHYNSLVDPRRLTIGA
GLGFSSLRGTNVDKDQVKAAIKAQQDKQINNALLAEGRFYSDLELTEKEIERMVIEVSRA
EYLADSTFKQQLGDRESSTSNAEPSSSGATGSSGTDRKTEHGKEHGSDLSSGMQMLLSMG
FSYMQAIEAYSIFGDDVDSMVCYLLETGSSSRRKGKATE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcgttttggttcagaggggttcttccggtggtggttcttcgtcgaacccgaac
cgcagtggtggtggtggtgggtcttcttctaattcctcggtgcgagcggagccgcaggtt
ccggttttgccggagaatagtgacgaggttgttgttgtgtcggatgaggttttggagagt
ggtgataaggggaagagtgaggagggtgttcattttgagcagggtgatgggtcgtgtgaa
gatgacgtggctgctgttgttgttgagagtgatgttagggaggagattgtgaaggggttg
agtgggcttagagttggtgaaagagttgtttcggagagtgagggttcgagtggggattct
tcttccctccttgttggtggtggttcgtgtccccctccacctccggtgccgcctcccaag
ccttccgtgacggggaacttgaattcgaggaggagtgtggccgggagtttgaattccggc
agcgtcggatcgtcgaggagggcagttacgtggccgattgtttcggctaggacttcacct
gctgggtctaggccgtcttctcccaggtcacataatgaaagtgaggggtacaacagtgct
gatgaacagaagccttgcctggtttcatcttatgatgattttgaaagggagcgacagttc
gaaattgatatcagaagggcaaaaggttatgaagtcaaaaaaatgatggaggatggaaat
tgtctattccgagctgttgcagatcaggtgtatggggattctgaagtgtatgatttgatc
agacagatgtgcatagattatatggagcgagagagagatcacttttctcagtttataact
gaaggcttcacatcttactgcaagagaaagagaagagacaaggtctatggaaataatgtt
gagatccaagccatgtgtgaaatgtataatcgtccaattcacatatactcctacaccaca
gaacctatcaatatctttcatggaagctacaacactgacatgccaccaatacgattgagt
tatcatcatgggaatcattacaactcccttgttgatccacggcgcttgacaattggtgct
gggcttgggttcagcagtcttcgtggaacaaatgttgacaaagatcaagtcaaggctgct
attaaagctcaacaagacaaacagatcaataatgcactgttagccgagggtcggttttac
tctgatctcgagctcacagaaaaggaaattgaacgcatggtgattgaagtttctcgagct
gagtaccttgcagatagtacatttaagcaacagcttggagacagagagtcctctacctca
aacgcagaaccatcatcttctggagcaaccggttcatctggcactgatcgcaagacggaa
catgggaaagagcatggttctgatcttagtagcggtatgcagatgttactatcaatggga
ttcagttacatgcaagcgattgaggcttacagcatatttggggacgatgttgattccatg
gtttgttacctgttagaaactggcagtagcagcagacgtaaaggcaaggccactgaatga

DBGET integrated database retrieval system