KEGG   Glycine max (soybean): 100809207Help
Entry
100809207         CDS       T01710                                 

Definition
histone acetyltransferase HAC1-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100809207
Transcription factors [BR:gmx03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    100809207
Mitochondrial biogenesis [BR:gmx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100809207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1728 aa AA seqDB search
MKLQAHIPGEMSGQVPNQAGSQLSGLTQLNGNALTHQMPPLGGVPRSTINMDPEFLRART
FIQEKIFDMLLQRQQLPVTDVQRRKLKDLANRLEEGMLKAALSKEDYMNLDTLESRLSNF
LRRASMNNHNQQYPQRVNSSPIGTMIPTPGMSHVPNSSMMVASSMDASVISASGRNSIAS
TSFNSVNMLPAGGMLGSTLNRFDGLSNGYQQSSTSFSAASGGNISSMGVQRIASQMIPTP
GFTVSSNHSHMNIDSNNTNGGAFSSVESTMVPLSQLQQQKQHVGGQNSHVLQNLSGQMGS
GMRSGLLQKPFANSNGAISSGSGLIGNNIQLTNEPGTSSDSYASTYANSPKHLQQPFDQK
QKPVVQGDGYGMNNVDNFASGNFYTSATSSGSMMNNQNTNSVKLPSMPKISSLMNSHSNL
HGMQQAAHIKSQPTNQLEKLNFQSSLTSRDGLLHSQQQYQQRPQQLQQPDQYAQQQFQSM
QSQQPPHVINSDTFSQSLLSSNLENRVKPEPGIEHHKEVPNSHVSEQFHISEMQSQFHQN
SSEDCSRGAQYLPFPSGHHDLLSSTPQISQQMLHQHQLVAESQNNFNKSVILNQWPQSQD
CNHIPDSISHDQHLHMDFHQRISGQDEAQCNNLSSDGSIIGRAVLSRGSAEQLDSGNAIK
KAHRNQQRWLLFLLHARRCSAPEGRCKERFCSNAQKLCKHLDRCTLRHCQYPRCHHTRVL
LHHFINCKDPCCPVCVFVRKYRRAFQLKPQIQPEPESSLPTAVNGSCKPYNIVGTSPRLI
SKPPLVVETSEDLHPSIKRIKIEHCAQPINPENDHSASSFTENCESVVSRDAQSQPQAYP
NIEKSISIESELTEVKAEAPAHVVHEKLSEMKMDNNNADDKMPIAEPVKYDEPANLARPE
NIKTEKETGQDRKENVVQTSENAAGTKSGKPKIKGVSLTELFTPEQVREHITGLRQWVGQ
SKSKAEKNQAMEHSMSENSCQLCAVEKLTFEPPPIYCTTCGVRIKRNNMYYTTGTGDTRH
YFCLPCYNDARTENIIVDGTPIAKSRLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGR
RNDGGQAEYTCPNCYIQEVERGERKPLPQSAVLGAKDLPRTILSDHIEQRLFKRLKQERQ
ERARLQGKSYDEIPGAEALVIRVVSSVDKKLEVKPRFLEIFQEENYPTEFPYKSKVVLLF
QRIEGVEVCLFGMYVQEFGSECQFPNQRRVYLSYLDSVKYFRPEVKAVTGEALRTFVYHE
ILIGYLEYCKKRGFTSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKAAK
ENIVVDLTNLYDHFFVSTGECRAKVTAARLPYFDGDYWPGAAEDLIYQLRQEEDGRKQNK
KGTTKKTITKRALKASGQSDLSANASKDLLLMHKLGETICPMKEDFIMVHLQHACTSCCI
LMVSGNRWVCNQCKNFQICDRCYEAELKREERERHPINQREKHTLYPVEITDVPSDTKDK
DDILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNICYL
DIETGQGWRCEVCPEYDVCNACYQKDGGIDHPHKLTNHPSMVDRDAQNKEARQHRVSQLR
KMLDLLVHASQCRSAHCQYPNCRKVKGLFRHGMHCKTRASGGCVLCKKMWYLLQLHARAC
KESECHVPRCRDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEVANNAG
NT seq 5187 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcaggcacatattccgggggagatgtcaggacaggtacctaatcaagcaggg
tctcaattgtctggtctgacccaactgaatgggaatgcactcactcatcagatgccacct
ttagggggtgtaccgcgttcaacaattaatatggatcctgaatttcttagagctcgcact
tttattcaagagaagatctttgatatgttgttgcaacgacaacagctgccagttacagat
gtacagagaaggaagcttaaggatcttgcaaaccgcttggaggagggcatgttaaaagct
gctctctctaaggaggattacatgaacttggatacactggagagtcgtttatctaatttc
ctccgacgagcatctatgaataatcacaaccaacaatatccgcagcgtgttaactcttct
ccaattggtacaatgataccaacccctggtatgtcacatgttccaaattcaagcatgatg
gttgcatcttctatggatgcctctgtgatttctgccagtgggcgtaatagcatagcatca
acatctttcaatagtgtaaacatgttaccagctggtggtatgcttggcagtaccttaaat
agatttgatggtttgtctaatggctatcagcagtcttctaccagcttttctgctgcctca
ggggggaacatttcatcaatgggggtgcagagaattgctagccagatgattcccactcct
ggattcacagtcagcagtaatcactcacacatgaatatagattctaataatactaatggt
ggtgccttttccagtgtagagtctactatggtaccactgtcacagctacagcagcagaag
cagcatgttggtggccaaaatagtcatgtattgcagaacctcagtggccaaatgggtagt
ggaatgagatctggtttactacagaagccatttgcaaactcaaatggtgctataagtagt
ggatcaggcttgattggaaataatatacagcttacaaatgaacctggcacttcttctgac
agctatgcctcaacttatgctaattcccctaaacacttgcagcagcccttcgatcaaaaa
cagaaaccagtagtgcagggtgatggatatggaatgaataatgttgacaattttgcttct
ggaaacttttatacatctgcgacatcctctgggtctatgatgaacaatcagaacactaat
tcagttaaattaccatcaatgcccaaaattagctcattgatgaatagtcactcaaatttg
cacggtatgcagcaggctgctcatataaagtcccaaccaactaaccagctagaaaagttg
aattttcagtcttcattgacttcaagagatggccttctgcattctcaacagcagtatcag
caaaggcctcaacaattgcagcagccagatcagtatgcacaacagcaatttcaatctatg
caaagtcaacagcctccacatgtgatcaacagtgacacattcagtcagtctctgctatct
tccaatctagaaaaccgagtgaagcctgaacctggaattgaacatcataaagaagtgcct
aattctcatgtctctgaacagtttcacatatctgagatgcagagtcagttccatcagaac
tcatctgaagattgctctaggggtgctcaatatcttccattcccatctggtcaccatgat
ttattgtcatcaacacctcaaatttcacaacaaatgttgcaccagcatcaattggttgca
gagtctcaaaataatttcaacaaatctgtaattctaaaccaatggcctcaatcacaagat
tgtaaccacatacctgacagtatttcacatgatcaacatctccacatggattttcatcaa
agaatatctgggcaagatgaagctcaatgcaataatttatcgtcagatggatctattatt
ggtcgagctgttctttctagaggctcagctgagcaactggactctggaaatgctataaaa
aaggcgcacaggaatcaacagaggtggcttttatttctacttcatgcacgacggtgttct
gcccctgaaggacgatgcaaagaacgcttttgttctaatgcacagaagttatgcaagcac
ttagatagatgcaccctgcgccattgccaatatcctcgttgccatcataccagggtgttg
cttcatcatttcataaactgcaaggatccatgttgccctgtttgtgtttttgtgagaaag
tatcgacgtgcatttcaactcaagcctcagattcagccggaacctgaatccagcttgcca
actgcagtgaatggatcctgtaaaccttacaatattgtaggcacatcgcctagattgatc
tcgaagcctccattagttgttgaaacttccgaggacttgcacccatctataaaacgtata
aagattgagcattgtgcccagcctattaatcctgaaaatgaccattctgcttcatctttt
acagaaaattgtgaatctgttgtttccagggatgctcagtctcaaccccaagcttatccc
aatattgagaagtctatctcaatcgaatctgagcttacagaagttaaggctgaagctcct
gcacatgtggtacatgaaaaattaagtgagatgaaaatggataacaataatgcagatgat
aaaatgcctattgctgaacctgtcaaatatgatgaacctgctaatttagctaggcctgaa
aatataaaaactgagaaagaaactggacaagacaggaaagaaaatgttgtgcagacatct
gaaaatgcagctggaaccaagtctggcaagccaaaaataaaaggagtctcattaactgaa
ttatttactccagagcaagtcagggaacatatcactggcctcaggcaatgggttggccag
agcaagtcaaaagcagagaagaatcaagcaatggagcattcaatgagtgagaactcctgc
caattgtgtgctgtagagaagcttacctttgaaccaccgcctatttattgcacaacttgt
ggggttcgcattaaacgaaataatatgtattataccacgggcaccggtgacacacggcat
tatttttgtcttccatgctataatgatgctcgtacagagaacatcattgttgatgggact
cccattgccaaatcaagattggaaaagaagaagaatgatgaggaaactgaggaatggtgg
gttcaatgtgataaatgtgaagcatggcaacatcaaatttgtgctttatttaatggcaga
agaaatgatggtggacaagctgaatatacttgccctaactgctatattcaagaggtagaa
agaggagagcgcaagcccttaccgcaaagtgctgttcttggagccaaggatttgccgaga
actattctcagtgatcacatagaacagcgattatttaaacggctaaagcaagaaagacaa
gaaagggcaaggcttcaaggaaaaagttatgatgagattcctggagctgaagctcttgtt
ataagagttgtgtcatctgttgacaaaaagttagaagtgaaaccgcggtttctggagatt
tttcaggaagagaattacccaacagaatttccatataaatcaaaggtagttttgttgttt
caaaggatagaaggtgtggaagtttgcctatttggcatgtatgttcaagaatttggatct
gaatgtcaatttcctaatcagcgccgcgtgtacctttcatatttggattctgtgaagtat
tttaggcctgaggttaaagcagtgacgggagaggctcttcggacttttgtttaccatgaa
attctgattggatatcttgaatattgcaagaaacgtggttttacaagctgctatatctgg
gcttgtcctccattaaagggggaagattatattttatattgccatccagaaattcagaaa
accccaaaatccgataagctacgtgaatggtatctggccatgttaagaaaagctgcgaag
gagaatattgtggtcgacctcaccaacttatacgatcatttctttgtatctactggtgaa
tgtagggctaaggttactgccgcaagactcccgtattttgatggtgactactggcctggg
gctgcagaggatttgatttatcagcttcgccaagaggaagatggaaggaaacaaaataaa
aagggaacaactaaaaagactataacaaaaagggctttgaaagcgtctggtcagtcagat
ctttcagcaaatgcctcaaaggacctgctccttatgcacaaacttggtgaaaccatttgc
ccgatgaaggaagattttattatggttcatttgcagcatgcatgtactagctgttgtatt
ttaatggtgtctggcaaccgttgggtttgcaaccagtgcaagaattttcagatttgtgat
aggtgttacgaagcagaactaaagcgtgaagagagagaaagacatcctattaaccagagg
gagaaacatactctttatcctgttgaaattactgatgttccttctgatacaaaggacaaa
gatgatattcttgagagcgaattctttgacactagacaggcatttctgagtctctgccag
ggaaatcattaccagtatgatacactaagacgggccaagcattcctcaatgatggttctc
tatcatcttcataatccaacggctccagcatttgtgacaacttgcaatatatgttatctt
gacatagaaactggtcaaggatggcgctgtgaggtttgccctgagtatgatgtatgcaat
gcttgttatcaaaaggatggaggtattgatcatcctcataagttgacaaatcatccatcc
atggtggatcgtgatgctcagaacaaagaagcaaggcagcatcgagtatcgcagctacgg
aaaatgcttgatctccttgttcatgcatcccaatgtcgttctgcacattgccaatatccc
aattgtcgcaaggtgaagggacttttccgccatggaatgcactgcaaaacacgagcttct
ggaggttgtgttctttgcaagaaaatgtggtatttgcttcaacttcatgctcgtgcttgc
aaagaatctgaatgccatgtaccacgttgcagagatttaaaagaacatctaaggagactt
cagcaacagtctgattcacggcgtagagctgctgtaatggaaatgatgaggcagagagcc
gcagaagttgctaacaatgctggatga

DBGET integrated database retrieval system