KEGG   Glycine max (soybean): 100809770Help
Entry
100809770         CDS       T01710                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
gmx  Glycine max (soybean)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100809770
  Lipid metabolism
   00062 Fatty acid elongation
    100809770
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100809770
Lipid biosynthesis proteins [BR:gmx01004]
 Fatty acid synthase
  Component type
   100809770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 367 aa AA seqDB search
MALPSLSFLFIFTSFIVSVSHSIPFIVIHGIGDQCSNRGVKKFTQQLSSFSGAEGYCVEV
GNGSWDSWFEPLKEQAEIVCEKVKQMKELKEGYNIVGLSQGNLIGRGVVEFCEGGPPVKN
FISLAGPHAGTASVPLCGSGIFCVLADTLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLE
NCRFLPVLNNEIPDKRNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGYFKPV
LPPQSTELYIEDWIGLRTLDEAGKVHFISVPGNHLGISQEDMKKHVVPYLKDHIFVQDSI
NKARFRLRGVNQKVIQSNMMEQSQKEEVEPSSSPLLDGSLPYWWPTPFKTFLGELIGINE
EESIQRK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggctcttccttcactatcctttctcttcatcttcacttccttcatcgtctccgtctca
cactcaataccctttattgttattcatggaattggggatcagtgctctaatcgtggagtg
aaaaaattcacacagcaattgagcagcttctctggtgctgaaggatattgtgtcgaggtt
ggaaatggatcatgggattcatggtttgagcctttgaaagagcaggctgagattgtttgt
gaaaaggtgaagcaaatgaaagaattgaaggaaggatacaacattgttggactttcccag
ggaaatttaattggtcgaggcgttgtggaattttgtgaaggaggacctcctgttaaaaac
tttatctctttagcaggccctcacgctggtactgcttcagttcccctatgtggttcaggt
atcttctgcgttcttgcagacaccctcatcaagggagaggtttacagtagctatattcaa
gaacacttggctcctagtggatatcttaaattaccgaatgccatacctgattatttggag
aactgtagatttcttccagtgcttaacaatgaaataccagataagagaaattctacttac
aaggaaagatttagtagcttgcagaatttggtacttatcatgtttgagcacgacactgtt
ttaataccaaaggaaacttcctggtttggatattacccagatggctacttcaagccagtt
ttaccaccacaatcaacagaactctacattgaggattggataggcttaagaactctagat
gaagctggaaaagttcacttcattagtgttccaggaaatcatcttggaatctcccaagag
gatatgaaaaagcatgtagtgccatatttgaaggatcacatattcgtacaagatagtatc
aataaggctaggttcaggttgcgaggagttaatcagaaagttattcaaagtaatatgatg
gaacaatctcaaaaggaggaggtggaaccatcatcctccccattacttgatggatcattg
ccatactggtggcctacaccattcaagactttccttggtgaattgattggcattaatgaa
gaggaatctatacaaaggaaataa

DBGET integrated database retrieval system