KEGG   Glycine max (soybean): 100809770Help
Entry
100809770         CDS       T01710                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
gmx  Glycine max (soybean)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gmx01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:gmx00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 367 aa AA seqDB search
MALPSLSFLFIFTSFIVSVSHSIPFIVIHGIGDQCSNRGVKKFTQQLSSFSGAEGYCVEV
GNGSWDSWFEPLKEQAEIVCEKVKQMKELKEGYNIVGLSQGNLIGRGVVEFCEGGPPVKN
FISLAGPHAGTASVPLCGSGIFCVLADTLIKGEVYSSYIQEHLAPSGYLKLPNAIPDYLE
NCRFLPVLNNEIPDKRNSTYKERFSSLQNLVLIMFEHDTVLIPKETSWFGYYPDGYFKPV
LPPQSTELYIEDWIGLRTLDEAGKVHFISVPGNHLGISQEDMKKHVVPYLKDHIFVQDSI
NKARFRLRGVNQKVIQSNMMEQSQKEEVEPSSSPLLDGSLPYWWPTPFKTFLGELIGINE
EESIQRK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggctcttccttcactatcctttctcttcatcttcacttccttcatcgtctccgtctca
cactcaataccctttattgttattcatggaattggggatcagtgctctaatcgtggagtg
aaaaaattcacacagcaattgagcagcttctctggtgctgaaggatattgtgtcgaggtt
ggaaatggatcatgggattcatggtttgagcctttgaaagagcaggctgagattgtttgt
gaaaaggtgaagcaaatgaaagaattgaaggaaggatacaacattgttggactttcccag
ggaaatttaattggtcgaggcgttgtggaattttgtgaaggaggacctcctgttaaaaac
tttatctctttagcaggccctcacgctggtactgcttcagttcccctatgtggttcaggt
atcttctgcgttcttgcagacaccctcatcaagggagaggtttacagtagctatattcaa
gaacacttggctcctagtggatatcttaaattaccgaatgccatacctgattatttggag
aactgtagatttcttccagtgcttaacaatgaaataccagataagagaaattctacttac
aaggaaagatttagtagcttgcagaatttggtacttatcatgtttgagcacgacactgtt
ttaataccaaaggaaacttcctggtttggatattacccagatggctacttcaagccagtt
ttaccaccacaatcaacagaactctacattgaggattggataggcttaagaactctagat
gaagctggaaaagttcacttcattagtgttccaggaaatcatcttggaatctcccaagag
gatatgaaaaagcatgtagtgccatatttgaaggatcacatattcgtacaagatagtatc
aataaggctaggttcaggttgcgaggagttaatcagaaagttattcaaagtaatatgatg
gaacaatctcaaaaggaggaggtggaaccatcatcctccccattacttgatggatcattg
ccatactggtggcctacaccattcaagactttccttggtgaattgattggcattaatgaa
gaggaatctatacaaaggaaataa

DBGET integrated database retrieval system