KEGG   Glycine max (soybean): 100809972Help
Entry
100809972         CDS       T01710                                 

Definition
aldose 1-epimerase-like
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gmx00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gmx00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 339 aa AA seqDB search
MADESPKPETFELNNGSMQVLLTNLGCTIISLSVPGKDGVLSDVVLGLESVESYQKGLAP
YFGCIVGRVANRIKDGKFTLDGIHYSLPINNPPNSLHGGNVGFDKKVWEVVEHKKGETPS
ITFKCHSHDGEEGYPGDITVTATYTLTSSTTLRLDMEGVPKGKPTIVNLAQHTYWNLAGH
NSGNILDHSIQLWANHITPVNENTVPTGEIMPVKGTPFDFTSFNRIGSTISQVGLGYDHN
YVLDCGEEKEGLRHAAKVRDPSSSRVLNLWTNAPGVQFYTANYVNGVQGKGGAIYGKHAG
LCLETQGFPNAINQPNFPSVVVRPGEKYQHTMLFEFSLE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgagagccccaaaccagagaccttcgaactcaacaatggaagcatgcaggtc
ctcctcaccaatctcggctgcaccatcatctccttatccgtacctggaaaagatggtgtg
ttatctgacgttgttcttggccttgaatctgttgaatcctatcagaaaggtcttgctcct
tattttggctgcattgtgggtcgagttgctaaccgaattaaggatggcaagtttacactt
gatgggattcattactctttgcctatcaacaatccaccaaacagtctccatggtggaaat
gttgggtttgataagaaggtatgggaggtagttgaacataagaaaggcgaaaccccctca
atcacttttaagtgccacagtcatgatggagaggaaggttatcctggggatatcactgtt
actgccacttacacactcacctcaagcacaactctgaggcttgacatggaaggagtgcca
aagggcaagcccaccatagttaacttagctcagcatacctactggaacttagctggccac
aactcagggaatatacttgaccattcaattcagttatgggctaatcatatcacacctgtg
aacgagaataccgtgccaaccggtgaaatcatgccagtgaagggtaccccttttgatttt
acatcttttaatagaataggcagcaccattagtcaggttggactgggatatgatcacaat
tatgtgcttgattgtggggaagagaaagagggtttgagacatgctgcaaaagtgagggat
ccatcaagttcaagagtacttaacttgtggacaaatgcccctggtgtgcaattttacact
gcaaactatgtgaatggtgttcaaggaaaaggaggtgctatatatggaaagcatgctggg
ttatgtctcgagacacagggattccctaatgccataaaccagccaaattttccttctgtt
gtggttcgtccgggcgagaagtatcaacataccatgttgtttgagttttcacttgagtga

DBGET integrated database retrieval system