KEGG   Glycine max (soybean): 100810190Help
Entry
100810190         CDS       T01710                                 

Definition
protoporphyrinogen oxidase, chloroplastic-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gmx  Glycine max (soybean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100810190
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     100810190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 543 aa AA seqDB search
MVSVFNEILFPPNQTLLRPSLHSPTSFFTSPTRKFPRSRPNPILRCSIAEESTASPPKTR
DSAPVDCVVVGGGVSGLCIAQALATKHANANVVVTEARDRVGGNITTMERDGYLWEEGPN
SFQPSDPMLTMVVDSGLKDELVLGDPDAPRFVLWNRKLRPVPGKLTDLPFFDLMSIGGKI
RAGFGALGIRPPPPGHEESVEEFVRRNLGDEVFERLIEPFCSGVYAGDPSKLSMKAAFGK
VWKLEKNGGSIIGGTFKAIQERNGASKPPRDPRLPKPKGQTVGSFRKGLTMLPDAISARL
GNKVKLSWKLSSISKLDSGEYSLTYETPEGVVSLQCKTVVLTIPSYVASTLLRPLSAAAA
DALSKFYYPPVAAVSISYPKEAIRSECLIDGELKGFGQLHPRSQGVETLGTIYSSSLFPN
RAPPGRVLLLNYIGGATNTGILSKTDSELVETVDRDLRKILINPNAQDPFVVGVRLWPQA
IPQFLVGHLDLLDVAKASIRNTGFEGLFLGGNYVSGVALGRCVEGAYEVAAEVNDFLTNR
VYK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggtttccgtcttcaacgagatcctattcccgccgaaccaaacccttcttcgcccctcc
ctccattccccaacctctttcttcacctctcccactcgaaaattccctcgctctcgccct
aaccctattctacgctgctccattgcggaggaatccaccgcgtctccgcccaaaaccaga
gactccgcccccgtggactgcgtcgtcgtcggcggaggcgtcagcggcctctgcatcgcc
caggccctcgccaccaaacacgccaatgccaacgtcgtcgtcacggaggcccgagaccgc
gtcggcggcaacatcaccacgatggagagggacggatacctctgggaagaaggccccaac
agcttccagccttctgatccaatgctcaccatggtggtggacagtggtttaaaggatgag
cttgttttgggggatcctgatgcacctcggtttgtgttgtggaacaggaagttgaggccg
gtgcccgggaagctgactgatttgcctttctttgacttgatgagcattggtggcaaaatc
agggctggctttggtgcgcttggaattcggcctcctcctccaggtcatgaggaatcggtt
gaagagtttgttcgtcggaaccttggtgatgaggtttttgaacggttgatagagcctttt
tgttcaggggtctatgcaggcgatccttcaaaattaagtatgaaagcagcattcgggaaa
gtttggaagctggaaaaaaatggtggtagcattattggtggaactttcaaagcaatacaa
gagagaaatggagcttcaaaaccacctcgagatccgcgtctgccaaaaccaaaaggtcag
actgttggatctttccggaagggacttaccatgttgcctgatgcaatttctgccagacta
ggcaacaaagtaaagttatcttggaagctttcaagtattagtaaactggatagtggagag
tacagtttgacatatgaaacaccagaaggagtggtttctttgcagtgcaaaactgttgtc
ctgaccattccttcctatgttgctagtacattgctgcgtcctctgtctgctgctgctgca
gatgcactttcaaagttttattaccctccagttgctgcagtttccatatcctatccaaaa
gaagctattagatcagaatgcttgatagatggtgagttgaaggggtttggtcaattgcat
ccacgtagccaaggagtggaaacattaggaactatatacagctcatcactattccccaac
cgagcaccacctggaagggttctactcttgaattacattggaggagcaactaatactgga
attttatcgaagacggacagtgaacttgtggaaacagttgatcgagatttgaggaaaatc
cttataaacccaaatgcccaggatccatttgtagtgggggtgagactgtggcctcaagct
attccacagttcttagttggccatcttgatcttctagatgttgctaaagcttctatcaga
aatactgggtttgaagggctcttccttgggggtaattatgtgtctggtgttgccttggga
cgatgcgttgagggagcctatgaggtagcagctgaagtaaacgattttctcacaaataga
gtgtacaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system