KEGG   Glycine max (soybean): 100811509Help
Entry
100811509         CDS       T01710                                 

Definition
endoglucanase 16-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100811509
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     100811509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 483 aa AA seqDB search
MGTKQVCWAIIVVWLTLFEGNTMLVKGDFNYKEALTKSLIFLEAQRSGKLPSNNRVPWRG
DSALDDGKLANVDLAGGYYDAGDNVKYGLPMAFTVTTLAWGAIFYKSEFKAANELDNIQD
AIRWGTDYFLKASSRHKRLYVEVGDPEDDHHCWAPPENMKTKRSVKMITSDTPGTEIAAE
TAAAMAASSIVFRPKDRKYARRLLNRAKLLFQMAKSHKGTFDGECPFYCSYSGYNDEMMW
AATWLYMATRKSVYMKYITEECMSASVAEFSWDLKYAGAQILLSQLHFEGQKNLETFKSH
AESFICSVLPDSPYHQIKLSPGGFIHLRDGANTQYATGTAFLFTVYSDLLDKHNQKVTCG
DKHFSSSHLLAFAKKQMDYILGKNPERRSYMVGFGKNPPTQAHHRGASVPKLKKDEEVVC
ATSFSKWFQKDAPNPHELTGAILGGPDFNDKFNDKRWDSPKTEPCTYINSLAAGALAKLA
SLS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggtactaaacaagtttgttgggccatcattgtagtatggcttacattgtttgaagga
aatacaatgcttgttaagggtgattttaattacaaggaggctctgaccaagtcccttatc
ttcctagaggcacaacgttcagggaagctcccttcaaataatagggtgccttggagagga
gactcagcactcgatgatggcaaactcgctaatgtggaccttgctgggggatactatgat
gcaggggacaacgtgaaatatgggctccccatggctttcaccgttactacgctagcatgg
ggagccattttttacaagtcagaatttaaagctgcaaatgagttagataatattcaagat
gccattcgttggggtaccgattattttctcaaagctagttctcgacacaaaagattatat
gtggaggttggggacccggaagatgatcaccattgttgggctccaccagaaaatatgaag
acaaagagaagtgttaagatgattactagtgacactcccgggactgagatcgcggctgaa
actgcagcagcaatggctgcttcttccattgtttttaggcccaaagatcgtaaatatgct
cgtcgtcttctcaacagagctaaattgcttttccaaatggccaaatcgcataaaggaact
tttgatggagagtgtcccttctactgctcttattccggctataatgacgagatgatgtgg
gcagcaacatggctatacatggcaaccaggaagtctgtgtatatgaagtacataacagaa
gaatgcatgagtgcaagtgtagcagaatttagttgggaccttaaatatgctggagctcaa
atccttctcagccagttacatttcgaaggtcaaaagaatttggaaacattcaaaagccat
gccgaaagtttcatatgctctgtcctacctgacagtccctaccaccagattaaactgtcc
cctggtggctttattcatttgagagatggagccaacacacagtatgccacgggcacagct
ttcttgttcactgtatatagtgatttgcttgacaaacataatcagaaagtcacatgtgga
gacaaacattttagctcctcccatctccttgcttttgctaagaaacaaatggattacata
ctagggaaaaaccctgaaagaagatcttacatggttggatttggaaagaacccaccaacg
caggctcaccatagaggtgcttcggtgccaaaactgaaaaaggatgaagaggtggtttgc
gccacgagcttctccaaatggtttcaaaaagatgcacctaacccccatgaactcactggt
gccatcttgggtggacctgacttcaacgacaagttcaacgataaacgttgggactcgcct
aagactgaaccatgcacttacatcaattccctagctgctggagctcttgccaagcttgca
tctttgagttga

DBGET integrated database retrieval system