KEGG   Glycine max (soybean): 100811593Help
Entry
100811593         CDS       T01710                                 

Definition
serine/threonine-protein phosphatase PP1 isozyme 4-like
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
gmx  Glycine max (soybean)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:gmx03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 316 aa AA seqDB search
MSTQGQVIIDEAVLDDIIRRLTEVRLARPGKQVQLSESEIKQLCVASRDIFINQPNLLEL
EAPIKICGDIHGQYSDLLRLFEYGGLPPTANYLFLGDYVDRGKQSLETICLLLAYKIKYP
ENFFLLRGNHECASINRIYGFYDECKRRFNVRLWKAFTDCFNFLPVAALIDDKILCMHGG
LSPELTNLDEIRNLPRPTAIPDTGLLCDLLWSDPGRDVKGWGMNDRGVSYTFGPDKVAEF
LTKHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMMSVDENLMCSFQI
LKPAEKKSKFVMSNKM
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagcacacaggggcaagtgattattgatgaggcggttctggatgacataatccggcgc
ttaacggaggtccgactggcccgacccggcaagcaggttcagctctccgagtctgagatc
aagcaactctgcgtcgcttccagagacatcttcattaaccagcccaatttgcttgaactc
gaagcccccatcaagatttgtggtgacattcatgggcagtacagtgatttgttaaggcta
tttgagtatgggggtttgcctcctactgcgaattatctctttttgggggactacgtggac
cgtgggaagcagagcttagaaaccatatgtcttttgcttgcgtataaaatcaaatatcca
gaaaactttttcctgttaagggggaatcatgagtgtgcttccattaataggatttatggg
ttttatgatgaatgtaagcgaaggtttaacgtgaggctttggaaagcctttaccgactgt
tttaacttccttcctgtggcagcccttatagatgataaaatattgtgcatgcatggtggt
ctttcccctgaactcacaaacttggatgaaatcaggaatctacctcgtcctactgcgatt
cccgacaccggcttgctttgtgatttgctttggtctgatcctggtagggatgtgaagggt
tggggtatgaatgacagaggagtgtcctacacctttggccctgataaggtcgctgagttc
ttgacaaagcatgacttggacctcatttgtcgtgctcatcaggttgtagaggatgggtat
gaattctttgctgataggcaacttgttacgatattttcagctccaaactattgtggtgaa
tttgacaatgctggtgcgatgatgagtgtggacgaaaacttgatgtgctcatttcagatt
cttaagcctgcagagaaaaaatcaaagtttgtgatgtcaaacaagatgtga

DBGET integrated database retrieval system