KEGG   Glycine max (soybean): 100812398Help
Entry
100812398         CDS       T01710                                 

Definition
triosephosphate isomerase, chloroplastic-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100812398
   01230 Biosynthesis of amino acids
    100812398
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100812398
   00051 Fructose and mannose metabolism
    100812398
   00562 Inositol phosphate metabolism
    100812398
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    100812398
Enzymes [BR:gmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100812398
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100812398
  Exosomal proteins of bladder cancer cells
   100812398
  Exosomal proteins of melanoma cells
   100812398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 305 aa AA seqDB search
MAATSTSLFFSNLHSLNPQPFSSSLSFFRNVHSTLSFPSSSKPSRGVVAMAGSGKFFVGG
NWKCNGTKDSISKLVSDLNSATLEPDVDVVVAPPFVYIDQVKNSITDRIEISAQNSWVGK
GGAFTGEISVEQLKDLGCKWVILGHSERRHVIGENDEFIGKKTAYALSEGLGVIACIGEL
LQEREAGQTFDICFQQLKAFADAVPSWDNIVIAYEPVWAIGTGKVATPEQAQEVHAAVRD
WLKKNVSAKVASKTRIIYGGSVNASNSAELAKQEDIDGFLVGGASLKGPEFATIINSVTS
KKVAA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacctcaacatcactcttcttctccaatctccattctctcaaccctcaacct
ttctcttcctcactctccttcttccgaaatgtccattccaccctctctttcccttcctct
tctaaaccctcccgtggcgttgttgccatggctggctctggcaagttctttgttggtggc
aattggaagtgtaatgggaccaaagactccatcagcaagcttgtctctgacttgaacagt
gcaacattggagcctgatgttgatgttgttgttgcacctccctttgtgtacatcgatcag
gtgaaaaactcaattacagataggattgaaatttctgcccagaattcttgggtgggaaaa
ggtggggctttcacgggagaaatcagtgtggagcaactaaaagaccttggctgcaagtgg
gttattcttggacattctgagcgaagacatgtaattggagaaaatgatgagtttatagga
aagaaaactgcctatgctttgagtgagggtcttggtgtgatagcatgtattggggaactt
ctacaagaaagagaagctggtcaaactttcgacatttgtttccagcaattgaaggctttt
gcagatgcagtgccaagttgggataatatagttattgcatatgagcctgtatgggcaatt
ggaactggcaaagtggccacacccgagcaagcccaggaagtccatgcagctgttcgtgac
tggcttaagaagaatgtctcagctaaagttgcatctaaaacacgaattatttatggagga
tctgtaaatgcaagcaacagtgctgagcttgcaaagcaagaagatattgatggatttctt
gttggtggtgcttcattaaagggtcctgagtttgctaccattatcaattcagtcacttcc
aagaaagttgcggcttaa

DBGET integrated database retrieval system