KEGG   Glycine max (soybean): 100812541Help
Entry
100812541         CDS       T01710                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase, chloroplastic-like
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gmx  Glycine max (soybean)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100812541
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     100812541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 395 aa AA seqDB search
MASSLFLCSNYVSPTSQNPFRSIHLAQFRPNGTSNFHSKLRFQRPHLVRAMVSDSNTSRR
QIEIVYDPEGRINKLADEVDREASLSRLTLFSPCKINVFLRITNKREDGYHDLASLFHVI
SLGDIIKFSLSPSKTKDSLSTNVSGVPLDDRNLIIKALNLYRKKTGSDKYFWIHLDKRVP
TGAGLGGGSSNAATALWAANQFSGCPASEKELQEWSSEVGSDIPFFFSQGAAYCTGRGEV
VQNIPPPVSLDVPMVLIKPPEACSTAEVYKCLRLDQTSNVDPLTLLEKISKIGISQDVCI
NDLEPPAFEVLPSLKRLKQRISAAGRGEYDAVFMSGSGSTIVGIGSPDPPQFVYDDDEYK
DVFLSDAYFLTREANQWYQEPASSPSASPVVSESV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcactctttctttgcagtaactacgtctcccccacctcccaaaaccccttc
agaagcatccatttagctcaattcagaccaaatgggacatccaattttcactcaaagctt
cggtttcagagaccccacttggttagagccatggtttctgattccaacacttccaggaga
caaatagagattgtgtatgaccctgaaggaaggataaacaagttggctgatgaagtagac
agggaagcttctctttcaaggcttactttgttctctccttgcaagataaatgtttttttg
agaataaccaacaagagggaagatgggtatcatgatttggcatccctttttcatgtgata
agtctaggtgacataattaagttctctttgtcaccttcaaaaaccaaggatagcctgtca
accaatgtgtctggcgtgccccttgatgatagaaatttgattattaaggcgcttaatctt
tataggaagaagactggcagcgacaagtacttttggattcatcttgataaacgggtgcct
actggggcagggcttggcggtggaagtagcaatgctgcaactgcactatgggcagcaaat
caatttagtggctgtcctgcctctgagaaagaactccaagaatggtcaagtgaggttgga
tcagacattcccttctttttctctcagggagcagcctattgcactggtcgaggagaggtt
gttcagaatattcctccaccagtatctctggatgttccaatggttctcataaagccccca
gaagcatgttcaactgctgaagtctacaagtgtctacgtttggatcagactagtaatgtc
gatcctttaacattgctggagaagatctcaaagattggtatctcacaagatgtttgtatt
aatgatttagaacctccagcatttgaagttctcccttctctcaaaagactgaagcagcga
attagtgcagctggtcgtggagaatatgatgctgtttttatgtcaggaagtggaagcacc
attgttggaattggttctcctgatcccccacaatttgtttatgatgatgatgaatacaaa
gatgtcttcttgtcagatgcctattttctcactcgagaggcaaatcagtggtaccaagaa
cctgcttcaagtccttctgcctctcctgttgtttcggagtctgtttaa

DBGET integrated database retrieval system