KEGG   Glycine max (soybean): 100812559Help
Entry
100812559         CDS       T01710                                 

Definition
NADH-cytochrome b5 reductase 1-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
gmx  Glycine max (soybean)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gmx00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 278 aa AA seqDB search
MEFSQSHRVEMISMAVALVAIVGGTAYYYYVTKKPKGCLDPENFKEFKLVKRTQLSHNVA
TFRFDLPTPKSVLGLPIGQHISCRGKDSLGEEVVKPYTPTTLDTDVGYFELVVKMYPQGR
MSHHFREIREGDYMAVKGPKGRFKYQPNQVRALGMIAGGTGITPMFQVTRAILENQQDKT
NINLIYANVTFDDILLKEELDAFAIKFPNQFKVYYVLNQPPEIWDGGVGFVTKEMIQTDF
PAPASDIKILRCGPPPMNKAMAANLEALGYSPQMQFQF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcgcagagtcacagggtagagatgataagcatggcagttgctcttgttgcc
attgttggtggcaccgcttactattactacgtcaccaagaagccaaaagggtgcttggat
cctgagaacttcaaagaatttaaacttgttaaacgcactcaactcagccataatgttgcc
acgttccgatttgatcttcctactcctaagtcagtgttgggacttcctattggacaacat
atcagctgcagagggaaggatagtcttggtgaagaagttgtgaaaccatatactcctaca
acattggatactgatgttggatactttgaattggttgtgaagatgtatccacaaggacgg
atgtctcatcactttagggagatacgtgaaggtgattacatggctgtgaagggaccaaag
ggacgttttaagtaccagcccaaccaagtaagagctttgggtatgattgctggtggcact
ggcatcaccccaatgtttcaagttacaagagctatattagaaaaccaacaggacaaaacc
aacataaatttgatatatgccaatgtcacatttgatgacattcttttgaaggaagagctg
gatgcctttgccattaagttccctaatcaattcaaagtttactatgttctaaatcagcca
ccagaaatatgggacggtggtgttggattcgtcactaaggaaatgatccaaacagatttc
cctgcaccagcatcagatattaagatattaaggtgtggaccacctcccatgaacaaggct
atggctgctaatcttgaagctcttggatacagtccccaaatgcagtttcagttttaa

DBGET integrated database retrieval system