KEGG   Glycine max (soybean): 100813292Help
Entry
100813292         CDS       T01710                                 

Definition
threonine synthase, chloroplastic-like
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gmx  Glycine max (soybean)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gmx01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gmx00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:gmx00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 521 aa AA seqDB search
MASSSLFQSLPFSLKTTKPYALPKPAANFVIRAQSPLTQNTNAASSASKHRRPADENIRD
EARRINAPHDHHLFSAKYVPFNADPSSSTTESYSLDEIVYRSQSGGLLDVQHDMDALKRF
DGEYWRNLFDSRVGKTTWPYGSGVWSKKEWVLPEIHDDDIVSAFEGNSNLFWAERFGKQF
LGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRKMNRPVVGVGCASTGDTSAALSAYC
ASAAIPSIVFLPANKISLAQLVQPIANGAFVLSIDTDFDGCMQLIREVTAELPIYLANSL
NSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFKMCQELGLVDKIPRLV
CAQAANADPLYLYFKSGWKEFKPVKSSTTFASAIQIGDPVSIDRAVHALKSCDGIVEEAT
EEELMDATAQADSTGMFICPHTGVALTALFKLRNSGLIKATDRTVVVSTAHGLKFTQSKI
DYHSKDIKDMACRYANPPMQVKADFGSVMDVLKTYLQSKTH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcatctctttttcagtctctccctttctctctcaaaaccactaaaccctac
gcgcttcccaaacccgccgccaatttcgtaatccgcgcccaatcccccctcactcagaac
accaacgccgcctcctccgcctccaagcatcgccgccccgccgacgagaacatccgcgac
gaggcccgccgcatcaatgctccccacgaccaccacctcttctcggccaaatacgtccct
ttcaatgccgacccttcctcctccacgacggagtcctactcgctcgacgagatcgtctac
cgctcccaatccggtggcctcctcgacgtccagcacgacatggacgccctcaagcgcttc
gacggcgagtactggcgcaacctcttcgactctcgcgtcggcaagaccacctggccctac
ggctccggcgtctggagcaaaaaagagtgggtcctccctgagatccacgacgacgacatc
gtctccgccttcgaaggaaactccaacctcttctgggccgagcgtttcggcaaacagttc
ctcggcatgaacgatttgtgggtcaaacactgcggaatcagccacaccggcagcttcaag
gatctcggcatgaccgtcctcgttagccaggtcaaccgcttgagaaaaatgaatcgcccc
gtcgtcggtgtcggttgcgcctccaccggtgacacctccgccgctttatctgcttattgc
gcttcggcggcgattccttccattgtgtttctgcctgctaataaaatctcgcttgctcaa
cttgttcagcctattgccaatggtgcctttgtgttgagtatcgacactgattttgatggt
tgcatgcagttgatcagagaggtcactgctgagttgcctatttatttggctaactctctc
aacagtttgagattggaagggcagaaaactgctgctattgagattctgcagcagtttgat
tggcaggttcctgattgggtcattgtgcctggtggcaaccttggcaacatttatgccttt
tacaaaggcttcaagatgtgtcaagagcttggtcttgtggataagattccaaggcttgtt
tgtgcccaggctgccaatgctgatcctttgtatttgtactttaaatccggctggaaggag
tttaagcctgtgaagtcaagcactacctttgcctctgccattcaaattggtgatcctgtt
tccatcgacagggcggttcacgccctaaagagttgcgatgggatcgtggaggaggccacc
gaggaggagttgatggatgctacggcgcaggcagattccactgggatgtttatctgcccc
cacactggggttgctttgactgctttgtttaagctcaggaacagtgggcttattaaggcc
actgataggactgtggtggttagcactgctcatggcctcaagttcactcagtccaagatc
gattaccattctaaggacatcaaggacatggcttgccgctatgctaaccctcccatgcaa
gtcaaggctgattttgggtcggttatggatgttttgaagacgtatttgcagagtaagact
cattag

DBGET integrated database retrieval system