KEGG   Glycine max (soybean): 100813488Help
Entry
100813488         CDS       T01710                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gmx  Glycine max (soybean)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100813488
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100813488
  Amino acid metabolism
   00310 Lysine degradation
    100813488
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100813488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 461 aa AA seqDB search
MFGVVRRRVASGSPSPWLLGQSVQNIRSGPSVSARASSIAIAFPSGGCGFVRNFSHITLG
SWINSKPMRVVIHPEATVQTLGRLFSSESGDTVDVVVPPLAESISDGTLAQFLKRPGDRV
NADEPIAQIETDKVTIDVSSPESGVILKLLANEGDTVEPGNKIAIISRSADATHVAPSET
TSEKGAPQPTQKVSEEKKAPKVETAPAKEKPKAPPAILKSPTEPQLPPKERERRVPMTRL
RKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSDYKDAFVEKHGVKLGLMSGFVKAAVN
ALQHQPIVNAVIDGDDIIYRDYIDISIAVGTSKGLVVPVIRNADTMNFADIEKQINAFAK
KANDGTLSIDEMAGGTLTISNGGVYGSLLSTPIINPPQSAILGMHSIVSRPTVVGGNIVP
RPLMYVALTYDHRIIDGREAVFFLRRIKDIVEDPRRLLLDI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtgtcgtaaggcgaagggttgcttctggcagcccgtctccttggttgcttggt
cagtcagttcagaacattcggtctggcccatcagtttctgctagagcttcttccattgcg
attgcatttccttcaggcggatgtggatttgtccgaaacttcagtcatataacccttgga
agctggattaattcaaagcctatgagggtggtcattcatccagaggcaaccgttcaaact
ttggggcgtctattttcttcagaaagtggagatacggttgatgttgtggttcctcctttg
gctgaatctatctctgatggaactctggcacaatttttgaagagacctggtgacagggtt
aatgctgatgaaccaattgctcaaattgaaacagacaaggtgacaattgatgtttcaagt
cctgagtcaggcgtgattctaaagcttctagccaacgaaggtgatactgttgagccaggt
aacaagatagcaatcatttcaaggtctgctgatgcaactcacgttgccccatctgagact
acatctgagaaaggtgctcctcagccaacccaaaaggttagcgaggagaagaaagctccc
aaagttgaaactgctcctgctaaagagaagcccaaagcacctcctgccattctgaagtct
cccaccgagccccagcttcctcctaaagaaagagaaagacgagttcctatgacaaggctt
cggaaacgagttgctacacggctgaaagattcccaaaacacgtttgctatgctgacaacc
ttcaatgaagttgatatgactaatttgatgaagctccgttctgattataaggatgctttt
gttgaaaagcatggagtcaaattggggcttatgtctggctttgtgaaagctgctgttaat
gcactccaacatcagccgattgtcaatgcagtcattgatggtgatgatattatatacaga
gattatatagatatcagcatagctgttggtacttcgaagggccttgttgtaccggttatc
cgcaatgctgataccatgaactttgctgatatagaaaagcagattaatgcttttgcaaag
aaggcaaatgatggaactttatcaattgatgagatggctggaggcactcttacaatatca
aatggtggtgtttatggaagccttttgagtacccctattatcaaccctcctcagtctgca
atcttgggtatgcattccatagtgagccgtccaacggttgttggaggaaatattgtccca
agaccattgatgtacgtggctctaacatatgaccacagaattattgatggaagagaggct
gtgttctttctgcgacgcatcaaagatattgtggaggatcctcgtaggcttctgctcgac
atatga

DBGET integrated database retrieval system