KEGG   Glycine max (soybean): 100813542Help
Entry
100813542         CDS       T01710                                 

Definition
peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
gmx  Glycine max (soybean)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:gmx01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:gmx00071]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:gmx00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 722 aa AA seqDB search
MSRSRGHTIMEVGPDGVAIITIVNPPVNSLSYDVLRSFKENFDQALQRDDVKAIVVTGAK
GRFSGGFDISAFGAQKPEERPKPGWLSVEIITDTIEAARKPLVAAIDGLALGGGLEFAMA
CNARLSTPTAKLGLPELQLGIIPGLGGTQRLPRLVGLTKALEMMLTSKPVKGKEAFSLGL
VDGLMSPDDLVNTACQWALDIMGRRRPWIASLYKTDKLEPLGEAREILKFARAQVQKRAP
NLQHPLVCIDVIEAGVVAGPRAGLWKEVEASEGLIKSDTSKSLIHVFFSQRGTSKVPGVT
DCGLVPRHVKKVAIIGGGLMGSGIATALILSSYPIILKEVNEKFLEAGINRIKANLQSRV
KKGKLTQENFENTVSLLKGTLDYESFKDVDMVIEAVVENVSLKQQIFADLEKYCPPHCIL
ASNTSTIDLNLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSAQVVVDVLDISKKI
KKTPVVVGNCTGFAVNRMFFPYTQAGLFLVEHGADVYQIDRVITKFGMPMGPFRLVDLVG
FGVAIATGMQFIQNFPERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKCKPSPDPELKNY
IEKARSFTGVSVDPKLVKLQEKDIIEMTFFPVVNEACRVLDEGIAVKGSDLDISAVMGMG
FPPYRGGILFWADSLGSKYIYSKLEKWSELYGEFFKPCAYLAARAAKGIPLSASVEQANS
RL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaagcagaggacacacgatcatggaggttggacctgacggggttgccatcatc
accatcgttaaccctcccgtcaattctctctcctatgatgtattgcgcagttttaaggag
aattttgatcaggctctacagagagacgatgtcaaggcaattgttgttacaggtgcaaag
ggaagattttctggaggttttgatatttctgcatttggtgctcaaaagccggaagagcgt
ccaaagcctggttggctatcggtagaaatcatcactgatactatagaagcggctaggaaa
ccattggttgctgccattgatggccttgccttgggtggaggcttagaatttgcaatggca
tgcaatgctcggttatcaaccccaactgctaagctaggcttgcctgaacttcagcttggg
ataattcctggattaggaggaacacagcgacttcctcgtcttgttggtttaacaaaggca
cttgagatgatgctgacttcaaaaccagttaaagggaaggaagcttttagtttggggctt
gtagatggtttgatgtcaccagatgatttggtaaacactgcatgccagtgggccctggat
atcatgggtcgccggcgaccatggattgctagtctttataagactgacaaactagaaccc
cttggggaagcaagagagattttgaaatttgcacgagctcaggttcaaaaacgggctcct
aatctccaacatcctttggtttgcattgatgttattgaagcaggagtagttgctggtccc
cgtgcaggactctggaaggaagttgaagcatctgaaggacttataaagtcagatactagc
aaaagcttaattcacgtatttttttctcagagaggaacatccaaggtacctggggttaca
gattgtggtttggttccaagacacgtcaagaaggttgccatcattggcggaggactaatg
ggctctggaatagcaacagctttaattcttagcagctatcctatcatattgaaagaagta
aatgagaagttcttagaagctggtatcaataggattaaagcaaacttacagagccgtgtt
aagaaaggtaaattgacccaggaaaattttgaaaacacagtctctcttctcaaaggtacc
cttgactatgaaagcttcaaagatgtggacatggtgatagaggctgttgttgagaatgtt
tccttaaagcaacagatctttgctgatctggaaaagtattgtccacctcattgtatactt
gcaagtaacacttccacaattgacttgaacctgattggagagaggaccaaatctcaagat
cgaattgttggagcccatttcttcagtcctgcacatgttatgccgcttctggaaattgta
cgtaccaagcagacctctgctcaagtggtagttgacgtgttagatatttcaaagaagata
aagaaaactccagtggtggttggaaactgcacaggatttgctgttaataggatgttcttc
ccatatacacaagccggtctctttcttgttgaacatggtgcagatgtttatcaaattgat
agagtaataaccaaatttggaatgcccatggggcctttcagattggtggaccttgttggg
tttggtgtggcgattgctactggcatgcaatttattcagaattttcctgagcgaacatat
aaatcaatgcttattccccttctgcaagaagataagagagctggcgaaacaactcgcaaa
gggttttatttgtatgatgataaatgcaagcctagtcctgatcctgaattgaaaaactat
atcgagaaagctaggagctttactggtgtctccgttgatcctaagcttgtcaagttacaa
gaaaaggacatcattgaaatgacattctttcctgtggtgaatgaggcttgtcgagtcctt
gatgaaggtattgcagtcaaaggatctgatcttgatatttctgctgtcatgggcatgggt
tttccaccttacaggggaggtatcctattctgggctgactctcttggatccaagtacata
tattcaaaattggagaaatggtcagagttgtatggagaattcttcaagccttgtgcctac
ttggctgcaagagctgccaaaggaattccactgagtgcctctgtggagcaggcaaattca
cggttgtaa

DBGET integrated database retrieval system