KEGG   Glycine max (soybean): 100813542Help
Entry
100813542         CDS       T01710                                 

Definition
peroxisomal fatty acid beta-oxidation multifunctional protein MFP2-like
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
gmx  Glycine max (soybean)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100813542
  Lipid metabolism
   00071 Fatty acid degradation
    100813542
   00592 alpha-Linolenic acid metabolism
    100813542
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100813542
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100813542
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100813542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 722 aa AA seqDB search
MSRSRGHTIMEVGPDGVAIITIVNPPVNSLSYDVLRSFKENFDQALQRDDVKAIVVTGAK
GRFSGGFDISAFGAQKPEERPKPGWLSVEIITDTIEAARKPLVAAIDGLALGGGLEFAMA
CNARLSTPTAKLGLPELQLGIIPGLGGTQRLPRLVGLTKALEMMLTSKPVKGKEAFSLGL
VDGLMSPDDLVNTACQWALDIMGRRRPWIASLYKTDKLEPLGEAREILKFARAQVQKRAP
NLQHPLVCIDVIEAGVVAGPRAGLWKEVEASEGLIKSDTSKSLIHVFFSQRGTSKVPGVT
DCGLVPRHVKKVAIIGGGLMGSGIATALILSSYPIILKEVNEKFLEAGINRIKANLQSRV
KKGKLTQENFENTVSLLKGTLDYESFKDVDMVIEAVVENVSLKQQIFADLEKYCPPHCIL
ASNTSTIDLNLIGERTKSQDRIVGAHFFSPAHVMPLLEIVRTKQTSAQVVVDVLDISKKI
KKTPVVVGNCTGFAVNRMFFPYTQAGLFLVEHGADVYQIDRVITKFGMPMGPFRLVDLVG
FGVAIATGMQFIQNFPERTYKSMLIPLLQEDKRAGETTRKGFYLYDDKCKPSPDPELKNY
IEKARSFTGVSVDPKLVKLQEKDIIEMTFFPVVNEACRVLDEGIAVKGSDLDISAVMGMG
FPPYRGGILFWADSLGSKYIYSKLEKWSELYGEFFKPCAYLAARAAKGIPLSASVEQANS
RL
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaagcagaggacacacgatcatggaggttggacctgacggggttgccatcatc
accatcgttaaccctcccgtcaattctctctcctatgatgtattgcgcagttttaaggag
aattttgatcaggctctacagagagacgatgtcaaggcaattgttgttacaggtgcaaag
ggaagattttctggaggttttgatatttctgcatttggtgctcaaaagccggaagagcgt
ccaaagcctggttggctatcggtagaaatcatcactgatactatagaagcggctaggaaa
ccattggttgctgccattgatggccttgccttgggtggaggcttagaatttgcaatggca
tgcaatgctcggttatcaaccccaactgctaagctaggcttgcctgaacttcagcttggg
ataattcctggattaggaggaacacagcgacttcctcgtcttgttggtttaacaaaggca
cttgagatgatgctgacttcaaaaccagttaaagggaaggaagcttttagtttggggctt
gtagatggtttgatgtcaccagatgatttggtaaacactgcatgccagtgggccctggat
atcatgggtcgccggcgaccatggattgctagtctttataagactgacaaactagaaccc
cttggggaagcaagagagattttgaaatttgcacgagctcaggttcaaaaacgggctcct
aatctccaacatcctttggtttgcattgatgttattgaagcaggagtagttgctggtccc
cgtgcaggactctggaaggaagttgaagcatctgaaggacttataaagtcagatactagc
aaaagcttaattcacgtatttttttctcagagaggaacatccaaggtacctggggttaca
gattgtggtttggttccaagacacgtcaagaaggttgccatcattggcggaggactaatg
ggctctggaatagcaacagctttaattcttagcagctatcctatcatattgaaagaagta
aatgagaagttcttagaagctggtatcaataggattaaagcaaacttacagagccgtgtt
aagaaaggtaaattgacccaggaaaattttgaaaacacagtctctcttctcaaaggtacc
cttgactatgaaagcttcaaagatgtggacatggtgatagaggctgttgttgagaatgtt
tccttaaagcaacagatctttgctgatctggaaaagtattgtccacctcattgtatactt
gcaagtaacacttccacaattgacttgaacctgattggagagaggaccaaatctcaagat
cgaattgttggagcccatttcttcagtcctgcacatgttatgccgcttctggaaattgta
cgtaccaagcagacctctgctcaagtggtagttgacgtgttagatatttcaaagaagata
aagaaaactccagtggtggttggaaactgcacaggatttgctgttaataggatgttcttc
ccatatacacaagccggtctctttcttgttgaacatggtgcagatgtttatcaaattgat
agagtaataaccaaatttggaatgcccatggggcctttcagattggtggaccttgttggg
tttggtgtggcgattgctactggcatgcaatttattcagaattttcctgagcgaacatat
aaatcaatgcttattccccttctgcaagaagataagagagctggcgaaacaactcgcaaa
gggttttatttgtatgatgataaatgcaagcctagtcctgatcctgaattgaaaaactat
atcgagaaagctaggagctttactggtgtctccgttgatcctaagcttgtcaagttacaa
gaaaaggacatcattgaaatgacattctttcctgtggtgaatgaggcttgtcgagtcctt
gatgaaggtattgcagtcaaaggatctgatcttgatatttctgctgtcatgggcatgggt
tttccaccttacaggggaggtatcctattctgggctgactctcttggatccaagtacata
tattcaaaattggagaaatggtcagagttgtatggagaattcttcaagccttgtgcctac
ttggctgcaagagctgccaaaggaattccactgagtgcctctgtggagcaggcaaattca
cggttgtaa

DBGET integrated database retrieval system