KEGG   Glycine max (soybean): 100813942Help
Entry
100813942         CDS       T01710                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100813942
Transcription machinery [BR:gmx03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100813942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 543 aa AA seqDB search
MDFHGGGPLRSRSSQSPSPSHSASASATSSIHKRKLVSEDHAPPFPPSSFSADTRDGALT
SNDDLESISARGADSDSDSESEDAVVDDDEDDYDNDNDNDSSMRTFTASRLSNPPSAPRN
TKLKTENSTVKIENSDGAKDAGAVGSGAAAAAGPVPGIVVKEDPTKIFTDNLQTSGAYTA
REESLKKEEEAGKLKFVCLSNDGVDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHK
SVMVIRRNHVVGGITYRPYASQRFGEIAFCAITADEQVKGYGTRLMNHLKQFARDMDGLT
HFLTYADNNAVGYFIKQGFTKEIHLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMI
RRQRQAIDEKIRELSNCHIVYAGIDFQKKEAGIPKKIIDDIPGLREAGWTPDQWGHSRFR
TLNVSSDNATNQKHLNGFMRSLLKSMFDHADAWPFKEPVDARDVPDYYDIIKDPMDLKTM
SKRVDSEQYYVTFEMFVADARRMFANARTYNSPETIYYKCSTRLEAHFQSKVQAGLQPGT
KIQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggatttccacggcggaggaccactccgttcccgcagttcccagtccccttctccctct
cactccgcctccgcctccgccacctcctccatccacaagcgcaagctcgtgtccgaggac
cacgcgcctcccttccccccctcctccttctccgccgacacccgcgacggtgccctcacc
tccaacgacgacctcgagagcatctccgcccgcggcgccgactccgactccgactccgaa
tccgaggacgccgtcgtcgacgacgacgaggacgactacgacaacgacaacgacaacgac
tcctccatgcgcaccttcaccgcctccaggctcagcaaccctccctccgctccccgcaac
accaagctcaagaccgaaaactccaccgtcaaaattgagaattctgacggcgccaaagac
gccggagccgtcggatctggcgccgccgccgccgcgggaccggtccccgggattgtggtt
aaggaggacccgactaagatttttactgataatttgcaaaccagtggggcttacactgcc
agggaggagagtctcaagaaagaggaggaagcaggaaagctcaaatttgtatgcctttca
aacgatggtgttgatgaacatatggtttggttgattggattgaagaatatatttgctagg
caacttcccaatatgcccaaggagtacattgtccgacttgttatggataggagccataag
tctgtaatggttataaggcgcaatcacgttgttggaggcattacatatcgcccatatgct
agccagaggttcggtgagatagccttttgtgcaattacagctgatgagcaagtaaagggt
tatggtacccgattgatgaatcacttaaaacagtttgcacgtgatatggatgggctgaca
catttcctcacatatgctgacaataatgctgttggctattttatcaaacagggatttaca
aaagagattcacttggagaaagatcgatggcaaggttatataaaggattacgatggagga
attctcatggaatgcaagattgatccaaagctcccttacactgatttgtcaactatgatc
cgtcgtcaaaggcaggcaattgatgaaaaaatcagagagctgtcaaactgtcacatcgtt
tatgctggaattgattttcagaagaaagaagctggtattcctaaaaaaattattgatgac
atccctggtttgagagaggctgggtggactcctgatcagtggggtcattcacgattcaga
actttaaatgtttcttctgacaatgctactaatcaaaaacatttgaatgggtttatgcgt
tcacttctaaagtcaatgttcgatcacgctgatgcttggccattcaaggaaccagttgat
gcacgggatgtccctgattattatgacatcatcaaagatccaatggatttgaagacaatg
tctaagagggtggattcagagcaatattatgtaacatttgagatgtttgttgcggatgcc
agaagaatgtttgcgaatgcacgcacctataattctccagaaaccatttattacaaatgt
tctacaaggttagaagcccactttcaaagcaaagtgcaagcaggcctccagcctggtacc
aaaattcagtag

DBGET integrated database retrieval system