KEGG   Glycine max (soybean): 100814079Help
Entry
100814079         CDS       T01710                                 

Definition
Pyruvate dehydrogenase [lipoamide] kinase-like (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 369 aa AA seqDB search
MAAKKACETFSKSLIEEVNRWGCLKQTGVSLRYMMEFGSKPTNKNLLISAQFLHKELAIR
IARRAVELENLPYGLSQKPAVLKVRDWYVDSFRDVRAFPDIKNVNDEREFTEMIKAIKVR
HNNVVPTMAMGVQQLKKGMDPKIVYEDLVEIHQFLDRFYMSRIGIRMLIGQHVELHNPNP
PPHVVGYIHTKMSPVEVARNASEDARSICCREYGSAPDVHIYGDPNFTFPYVPAHLHLMV
FELVKNSLRAVQERFMNSDKVAPPIRIIVADGIEDVTIKVSDEGGGIARSGLPKIFTYLY
STARNPLDEHSDLGIGDNVTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSR
LGDSQEPLP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaaaaaggcatgtgagacattctcaaagtcattgattgaggaagtgaataga
tggggttgcttgaagcagacaggggtgagtctcaggtacatgatggaattcgggtccaaa
cccactaacaagaatttgctgatctctgcccagtttcttcacaaggaacttgccatcaga
attgccagaagggccgttgaacttgagaatcttccctatggtttgtctcaaaaacctgct
gttctgaaggttagggattggtatgtggattctttccgtgatgtcagagccttccctgac
atcaagaatgtgaatgatgaaagagagttcactgaaatgattaaggccatcaaagtgagg
cacaacaatgtggtacccacaatggccatgggagttcagcaattgaagaaaggtatggat
ccaaagattgtttatgaagatcttgttgagattcatcagttccttgaccgcttctacatg
tcaagaattggaatccgtatgcttatcgggcagcatgttgagttgcacaatcccaatcct
cctccccacgtcgtgggttacatacacacgaaaatgtctcctgtggaggtggcaaggaat
gccagtgaagatgcacgttctatatgttgtcgtgaatatggaagtgcccctgatgtccat
atttatggagatcctaattttacttttccgtatgttccagctcacttgcatcttatggta
tttgagttggttaagaactcactgcgtgctgtacaagagcgttttatgaattccgataaa
gttgcacctcccattagaataatagttgctgatggaatagaggatgttaccataaaggtc
tcagatgagggaggtggaattgcaagaagtggtttgcctaaaatttttacatatctatat
agtactgccagaaacccattggatgagcattcggatcttggaataggtgataatgtgaca
atggctggatatggatatggtcttcctattagtcgtctatatgctcggtattttggaggt
gatcttcaaataatctctatggaaggatatggcactgatgcatatctccatttgtctcgt
ttgggagattcacaagaacctttgccttga

DBGET integrated database retrieval system