KEGG   Glycine max (soybean): 100814224Help
Entry
100814224         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 15-like
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
15
AA seq 989 aa AA seqDB search
MLEPRESDIPVLFLVLVVLPLVAYILLGKWSETTKKRDRINLLAHLAAEEALRAEEMAVA
DVIPPVSASKNEHHVCARCSAPARTRCSRCKIVRYCSGNCQIIHWRLNHKQECQQLEPPK
SSSFPLAVSVEELGHGSYFYENLNSQYLGPSLKQTLRESAPLDNLVHPLTGTAAPATADF
SIFNNFQPSAFERTSHKSNRETLRRDNGSIYESSIESSDCKATSSLSSVVPKEAFMRQKS
RNSNDSVLEEEISNVNSGGFEVYINRFDASKNTTHEDDNHQSQYGNVSVTRHKYGRPSVS
SASNNDNTVDEFETEITARGVNVVKGGNYHSDEAAKYKRPSETTIKGSMKAKKILHTPKT
KSSKSPKSTSKTSADFCCSEIEKKGKTADELKVAGNSDTIPLHGNGSNGVASTGIMKMMG
LRKSTKPTPLASTEGIDVKCKKVTKIKMLFPYDEFVKIFQSDVFGIYPRGLLNCGNSCYA
NAVLQCLTSTKPLVIYLLYRSHSKACCAKDWCLMCELEQHIMILRENGAPLSPSRILWHM
RSINCHMGEGSQEDAHEFLRLLIASMQSICLEGLGGEKKVDPRIQETTFIQHTFGGRLQS
KVKCLNCNHESERYENIMDLTLEILGWVESLEDALTQFTSPEDLDGENMYRCGRCTSYVR
ARKQLSIHEAPNILTIVLKRFQEGRYGKINKCITFPEMLDMIPFMTGTGDIPPLYMLYAV
VVHLDTLNASFSGHYVSYVKDLQGNWFRIDDAEVQPVLINQVMSEGAYILFYMRSCPRPP
VEHTMNAMQQSVYDSSKHNPMEMQKPNKPGHSRHGSRQFFVPEPSPNTRPEITTHIIDTT
NGFLRKSTNRNALPVTQTYAENVRREFSDATSSDWSLFTSSDEASFTTESTRDSFSTVDY
GDSCNMDPISSIFNYPSEKSYLKFSHSRPVTRVFPEKGHVKQVQRIDHSKRVSHSSSNEH
PPNGNCGMYVYYGSNPVCGTTRTSSQCEF
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaccgcgagaatctgatatacccgtcctgtttctggtcttggttgtgcttccc
ttggtggcttacatcttacttggaaaatggagtgaaaccactaagaagagagataggata
aatttgcttgcccatttggctgctgaagaagctctgagagctgaagaaatggctgtggct
gatgtaattcctccagtgtctgcttcaaaaaatgaacatcatgtgtgtgctaggtgctct
gctccagccagaactcgctgctccagatgcaaaattgttagatattgctctggaaattgt
caaataatccattggaggctaaatcacaagcaagaatgccagcaactggaacctcctaaa
tcaagctcatttcctctggctgtttcagttgaggaacttggtcatgggagttacttttat
gaaaatttgaacagccagtacttaggtccctctttgaagcagactttaagggagagtgca
cctttggacaatttggttcaccctctgacgggcactgctgctcctgctacagctgatttt
tccatatttaataattttcaaccttctgcttttgaaagaacttcccataaatccaacaga
gaaacattgagaagagataatgggtctatttatgaatcttctattgaatcttctgattgt
aaagctaccagttctctctcaagtgtggtaccaaaggaggcgtttatgagacagaagtca
agaaatagcaatgattctgtgttggaggaagaaatttcaaatgtcaattctggtggcttt
gaagtttatattaacagatttgatgcatcaaaaaacacaacccatgaggatgacaaccat
caaagtcaatatggaaatgtatcagtaacaagacacaaatatggacgcccaagtgtgtca
agtgcttcaaacaatgataacactgtagatgaatttgaaacagagatcactgctagaggt
gtaaatgtagtcaaagggggaaattatcattctgatgaagcagcaaaatacaaacgccct
tctgaaacaacaatcaaaggaagcatgaaagctaaaaagatattacatactcccaagacc
aaatcttctaaatcaccaaagtcaacatcaaagacatcagctgacttttgttgctcagaa
atagaaaagaaagggaaaactgcagatgaactaaaagttgctggaaatagtgatactatc
cctttacatggtaatggtagcaatggggttgcaagcactggaattatgaaaatgatgggc
ttgaggaaatcgacaaaacctactcctcttgcctccacagaaggcattgatgtaaagtgc
aagaaggtgacaaagataaagatgttgtttccttatgatgaatttgtaaagatttttcag
agtgatgtctttggcatataccccaggggcctgttaaattgtgggaacagttgctatgcc
aatgctgtcttgcagtgcttaacttctacaaagcctctagtcatctatttgctttataga
tcgcactcaaaagcttgttgtgctaaagattggtgtctcatgtgtgagttagagcaacac
ataatgattttaagagaaaatggggctcctctatctcctagtcggatactttggcatatg
cggagcattaactgccatatgggtgaaggaagtcaggaagatgcccatgaatttttaagg
cttctaattgcatcaatgcaatctatatgcttggagggacttggtggtgagaaaaaagtt
gatcctagaatacaagaaacaactttcatacaacatacttttggtggccgtcttcaatcc
aaggttaagtgtttgaattgtaatcatgaatcagaaaggtatgagaacattatggacctg
accttggagatattgggttgggttgagtcactggaagatgcgctgactcagtttacttcc
cctgaagatttggatggagagaatatgtacagatgtggaaggtgcacatcatatgttcga
gctagaaagcaactgagcatacatgaggctcctaacatcttgactatagttctgaagaga
tttcaggaaggaagatatgggaaaattaacaagtgcataacttttcctgaaatgctggat
atgattcctttcatgaccgggacgggtgatattccaccactttacatgctttatgctgtt
gttgtgcacctggacacactaaatgcatctttctctggacactatgtttcatatgtgaaa
gatctgcaaggcaattggttcagaatagatgatgctgaggtacagccagtgctaattaat
caggtcatgtcagaaggagcatatatcctattctacatgaggtcctgtccccgtcctccg
gtagaacatactatgaatgccatgcagcaatctgtttatgattcttcaaagcacaatcca
atggaaatgcagaaacctaataaaccaggacatagtaggcatggcagtcgtcagtttttt
gtcccagagccatcacctaatactaggccagaaatcaccactcacattattgacaccacc
aatggcttccttagaaaaagcaccaataggaatgccctgccggtgacccaaacttatgcc
gaaaacgtcaggcgtgagttttcagatgccacatcaagtgactggtcccttttcactagc
tcagatgaggcttctttcacaactgagagcaccagggactccttcagcactgtagactat
ggtgattcatgcaacatggatccaatttcatctatcttcaactacccctcagaaaagtcc
tacttgaagttttcacatagtaggccagttaccagggtcttccctgaaaagggtcatgtt
aaacaagtacagaggattgatcattccaaaagggtcagccattcttcttcaaatgaacat
ccaccaaatgggaattgtggcatgtatgtatattatgggagtaatcctgtgtgtggtact
acccggacttctagtcagtgtgaattttag

DBGET integrated database retrieval system