KEGG   Glycine max (soybean): 100814545Help
Entry
100814545         CDS       T01710                                 

Definition
endoglucanase 24-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gmx00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 494 aa AA seqDB search
MALPKSNAKLTLVLLFLVFIINSGSAHNYKEALSKAILFFEGQRSGFLPQDQRQTWRANS
ALGDGWTYKLDLTGGYYDAGDNIKFGFPMAFTTTMLSWSVIEFGDMMPPNEHRNALLAIR
WATDYLLKTVSQPNRIFVQVGDPISDHNCWERPEDMDTNRTVYAVDAPNPASDVAGETAA
ALAAASMAFRSSDPSYSETLLRNAAKAFQFADTYRGAYSDNANVRSGVCPYYCDFDGYQD
ELLWGAAWLRRATQDENFLNYIQSNGKTLGAEDNINEFGWDNKHAGLNVLVSKEVLDGNV
MSLESYKTSAESFLCTLIPETSSSHIEYTPGGLIYRPGGSNLQHATSIAFLELVYANYLS
RTSQTINCGNVYVNAQTLRQHAKKQVDYILGDNPMGMSYMVGYSNKYPQHIHHRGSSLPS
IKDHPQFIACKEGSIYFNSSNPNPNVLVGAIVGGPGEDDVYEDDRADFRKSEPTTYINAP
FVGILAYFVANPNP
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggcacttcctaagtccaacgccaaactcactcttgttcttctttttcttgttttcatt
attaattcaggaagcgcccacaattacaaggaggcattgtccaaggcaatcctattcttc
gagggccaacgttcgggtttcttgccgcaggaccagagacagacctggcgcgccaattcg
gctcttggtgacggctggacctacaagctcgacctcaccggcggctactacgacgccggc
gacaacatcaaattcgggtttccgatggcattcaccaccacaatgctgtcctggagcgtc
atcgaattcggagacatgatgcctcccaatgaacaccgaaacgcgctgctcgcaatccgt
tgggctaccgattatttgctcaaaaccgtttctcagccaaaccgcattttcgttcaggtg
ggtgatccaatctctgaccacaattgttgggaaaggcctgaggacatggacacaaacagg
acagtgtatgctgttgatgctccaaacccagcttcagatgtagctggtgaaactgctgcg
gcactagctgctgcatcaatggcttttcgttcatcggatccttcttattcagagactttg
ctacgaaatgctgctaaggcctttcaatttgcagatacctataggggtgcctacagtgac
aatgctaatgttaggagtggtgtttgcccatattattgtgacttcgatggttatcaggac
gaattgttatggggagccgcatggctaaggagggctactcaggatgaaaatttcctcaac
tacattcaaagcaatggcaaaacccttggtgctgaagacaatataaatgagttcggttgg
gacaacaagcatgctggccttaatgttcttgtctccaaggaagttctagatggaaacgta
atgtctcttgaatcctacaagacttcagcagagagctttctgtgcacgctcatacccgaa
acatcaagttcacatatagagtacactcccggtggactaatatacaggcctgggggcagc
aacttgcaacatgcaacttcaattgcattccttgaattggtttacgccaattacctatct
cgcacttcacaaaccatcaattgtgggaacgtctatgttaacgcacaaacacttcgccag
catgctaagaagcaagttgattacattttgggagataacccaatgggtatgtcgtacatg
gttggttacagcaacaagtatccgcagcatattcaccaccgtggctcctctttaccctct
atcaaggaccatcctcaattcattgcctgcaaagaaggttcaatctacttcaactcaagc
aatcctaatcctaatgttctcgtgggagctattgtgggaggaccaggtgaagatgatgtg
tatgaggatgatagggctgattttaggaagtccgaaccaaccacatacattaatgcacca
tttgttgggattttagcatactttgttgctaatcccaacccttga

DBGET integrated database retrieval system