KEGG   Glycine max (soybean): 100814660Help
Entry
100814660         CDS       T01710                                 

Definition
polyprenol reductase 2-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100814660
    1.3.1.94  polyprenol reductase
     100814660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 342 aa AA seqDB search
MVFLFHNQPMEVVLVQMLRLAWVAATLPIIVASIPTPKLNCLRGTLLGFARRGKIMHSSS
QKVTISQRFFLHFYVVAFIWTTLLLVGTWAYAYSMVPLVVEPFSYSTITSFLTGGSTIRT
DTHKLRQGYVAWQAVFLLLMMEVHVLRRLYETIHVFNYSPSARMHAVGYLTGLFFYVGAP
LSLCGGCAVEVFNFLANLVTEFIVKGKNQMQVTELEFWQVVNPLFKLGWKHWIGAAVFLW
GWIHQHQCHKILGSLRHSRQADEYVIPHGDWFEIVSSPHYLSEIVIYASFVVATGGSNLT
IWLLFVFVVANLSFAAVETHGWYRQKFEDYPSSRFAIIPFIL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtttttctttttcataatcaaccgatggaggtggttctcgttcaaatgctgaggctg
gcatgggtcgctgccacgttacccatcatcgtcgcttctattcccactcccaagctcaac
tgcctccgtggcaccttgctgggttttgctcgtagaggcaaaatcatgcactcttcctcc
caaaaagtaactatttctcagaggttcttcttgcacttctacgttgtggcttttatatgg
acaacgttgctacttgttgggacttgggcatatgcgtacagcatggtgccacttgttgtg
gagccgttttcttactctactatcactagcttcttgactggtggttctactattagaact
gatacgcataaattgaggcagggatatgtggcctggcaagcggtttttctgcttttgatg
atggaagttcatgtcctcagacgcctttatgagacgatacatgtttttaactatagccct
tctgctcgcatgcatgccgttggttatctcactggattgtttttctacgtaggagcacca
ctatcgctgtgtggtggttgtgcagtagaggtgtttaacttcctagcaaatctagtgact
gagttcattgtcaagggcaagaatcagatgcaagtaacagagttagaattctggcaagtt
gtgaatcctctcttcaagcttgggtggaagcattggattggtgctgctgttttcttatgg
ggttggattcatcaacaccagtgccataagattcttggttctctacgacattcaagacaa
gcagatgaatatgtaattcctcatggtgattggtttgaaattgtctcctctccacattat
ctgtctgaaatcgttatatacgctagttttgtggtcgctactggaggatccaacctaaca
atctggctgctttttgtttttgtggtggcaaatctgtcatttgcagctgtggaaacacat
ggctggtatcgtcagaaatttgaagattatccaagtagtcgctttgctataattccattt
attctgtga

DBGET integrated database retrieval system