KEGG   Glycine max (soybean): 100815285Help
Entry
100815285         CDS       T01710                                 

Definition
aspartate carbamoyltransferase 2, chloroplastic-like
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 398 aa AA seqDB search
MAASSSLFSSSMHMEMFAPKTSKCPQNFVCCHSKISYIEPNYLKPVCCPNSRSLSMNMSS
KWEQTDRRDALHCRALKIEPAPSFSVGQKFQFDDIIEAQQFDRDILSAIFEVARNMENVE
KDSPGSQILKGFLMATLFYEPSTRTRLSFESAMRRLGGEVLTTENAREFSSAAKGETLED
TIRTIEGYSDIIVMRHFESGAARRAAAIADIPIINAGDGPGQHPTQALLDVYTIQREIGK
IDDIKVGLVGDLANGRTVRSLAYLLAKFKDVKIYFVSPDVVKMKDDIKDYLTSKGVEWEE
CADLVEVASECDVVYQTRIQKERFGEKIDLYEKARGKYIVNQGILNVMQRHAVVMHPLPR
LDEITLEVDADPRAAYFRQAKYGLYIRMALLKLLLVGW
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcttcttctcttttctcctcttcaatgcatatggagatgtttgctccaaag
acatcaaagtgtccccaaaattttgtatgctgtcatagcaaaatctcctatatagaacct
aattatttaaaaccagtatgctgtcctaattcaagatctttaagtatgaatatgtcatca
aaatgggaacaaacggatcgaagagatgcattgcattgccgtgctttgaaaattgagcct
gcaccttccttttcggtggggcagaaatttcaatttgatgatattatagaagctcaacag
tttgatagagatattctcagcgccatttttgaagttgcacggaatatggagaacgttgaa
aaggattctcctggtagccagattttaaagggttttcttatggccaccctattttatgag
ccttctactagaactagactttcatttgagtctgccatgagaagactaggcggagaggtt
ttaactactgaaaatgcgagagaattttcgtctgcggctaaaggagagacacttgaagat
acaatcagaacaattgagggttactctgatataattgtgatgcgacattttgaaagtggt
gctgccagaagagctgcagctatagctgacattccaataatcaatgcaggggatggtcct
ggacaacatccaactcaggcacttttagatgtctatacaattcaaagagagattggaaag
attgacgacataaaagttgggcttgtgggagaccttgctaatggcaggactgttcgttca
ttggcatacttgcttgctaagttcaaggatgtgaagatttattttgtttctcctgatgtg
gtaaaaatgaaggatgatataaaagactatttgacatcaaagggagtggaatgggaagaa
tgtgctgatttagtagaagtggcctcagagtgtgatgtggtttatcaaactcgtattcaa
aaagaaagatttggagaaaaaattgacctttatgaaaaggctagaggcaagtacattgtg
aatcagggtattctcaatgtgatgcagagacatgctgtggttatgcaccctcttccaaga
cttgatgaaatcaccttggaagttgatgctgatccaagggcagcttactttagacaagcc
aaatatggtctatatattcggatggcacttttgaaactcttgcttgttgggtggtag

DBGET integrated database retrieval system