KEGG   Glycine max (soybean): 100815697Help
Entry
100815697         CDS       T01710                                 

Definition
mitogen-activated protein kinase homolog MMK2-like
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100815697
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100815697
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100815697
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 373 aa AA seqDB search
MALESAPASADIRGVHTHGGRYVQYNIYGNLFEVSRKYVPPIRPVGRGAYGIVCAAVNAE
TREEVAIKKVGNAFDNRIDAKRTLREIKLLRHMDHENVIALKDIIRPPQRDNFNDVYIVY
ELMDTDLHQIIRSNQQLTDDHCRYFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLK
IADFGLARATSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIITRQPLF
PGKDYVHQLRLITELIGSPDDHSLGFLRSDNARRYVRQLPQYPRQQFATRFPSMSPGAVD
LLEKMLVFDPNRRITVKEALCHPYLAPLHDINEEPVCVRPFSFDFEQPSFTEEDIKELIW
RESVLFNPDPPIY
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgagtctgctcctgcttcagctgacatcagaggagttcacactcatggtgga
cgctatgttcagtacaatatctatggaaacctctttgaggtctctaggaagtatgttcct
cctattcgccctgtgggaagaggagcatatggtattgtttgtgctgctgtaaatgcagag
acacgtgaagaagttgccattaagaaggttggcaatgcatttgacaacagaatagatgcc
aaaaggactctacgagaaattaaacttcttcggcacatggatcatgaaaatgtgatagcc
cttaaagacattatacgaccaccacagagggataacttcaatgatgtgtacattgtttat
gagttaatggatactgatctgcatcaaataattcgatccaatcaacaattgactgatgat
cattgtcggtattttctttatcagttgctacgaggactcaaatatgtacactcagcaaat
gttctgcaccgtgatctaaagcctagcaacttgctactgaatgccaactgtgatcttaag
attgcagactttggtctcgctagagctacatctgagactgatttcatgactgagtatgtg
gttactcggtggtaccgagctccagagttacttcttaattgctcagaatatactgctgcc
atcgatatatggtctgtgggttgcatccttggtgaaatcataacaagacaacccctattt
ccggggaaagattatgttcatcagctcaggctgattacagagctcataggctcacctgat
gaccatagccttggatttttacgaagtgataatgctcgtagatatgtgagacagcttcca
caatatccaaggcaacaatttgctactagattcccaagtatgtctcctggtgctgttgat
ttgttagagaagatgcttgtctttgatccaaataggcgcattacagttaaagaagctctg
tgtcacccatacttggcacctcttcatgatattaatgaggaacctgtttgcgttagacct
ttcagttttgattttgagcaaccatctttcactgaagaagatatcaaggaactcatctgg
agagaatctgtgttattcaatcctgatccacctatttattga

DBGET integrated database retrieval system