KEGG   Glycine max (soybean): 100815763Help
Entry
100815763         CDS       T01710                                 

Definition
probable choline kinase 2-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
gmx  Glycine max (soybean)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100815763
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100815763
    2.7.1.82  ethanolamine kinase
     100815763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 381 aa AA seqDB search
MGATEEALQNLVNVNVVDAENPKNIKVSGTEDSVVNDKELGAKETPIKDKKDSIPGEVKE
MLKSLASEWENVVDINALQVIPLKGAMTNEVFQIKWQTTAGESSRKTLSASDLRDPSISA
LIAAKLKEFHDLDMPGPKTVNLWDRLRNWLSEAKRLCSPEEAEAFHLDTMDKEISALENF
LSDTHQRIGFCHNDLQYGNIMFDEESSSVTIIDYEYANYNPVAYDIANHFNEMAANYHTD
TPHVLDFTKYPDLEERRRFAHAYLSSSGEQPSDTEVEQLLDDIEKYAXXXXXTWLATAGI
QEHVNKIDFDYKEYAKQRLQEYWSRKTCLLGSHEYSSHDNATKVNGEQTLTSTTNRKPAK
RNSVSNKLKKIFGLGFFRSKH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgggggctactgaagaggccttacaaaatcttgtaaatgtaaacgttgttgatgcagaa
aatccaaaaaatattaaagttagtggtacagaagattcggtagtaaatgacaaagaatta
ggtgctaaagaaacccctattaaagataagaaagatagtattccaggtgaagtaaaagag
atgttgaaatcattggcaagtgaatgggagaatgtagttgatatcaatgcattgcaagtg
atccctcttaaaggggcaatgacaaatgaggtgttccaaataaaatggcaaacaacagca
ggagaatcctcaaggaagacattatcagcatctgatttgcgagatccatctatttctgct
cttatagcagccaaactgaaggagtttcatgatcttgatatgcctggcccaaaaaccgtg
aacctttgggataggttaagaaactggcttagtgaagccaagcgcttgtgttctcctgaa
gaagctgaagcatttcatttggacacaatggacaaggaaatatctgctttggaaaatttt
ttatcagacacccaccaacgcataggattttgccacaatgatttgcaatatggtaacata
atgtttgatgaagaatccagttctgtgaccataattgattatgaatatgcaaattataat
cctgtagcatatgatatagcaaaccactttaatgagatggctgccaactatcatacagat
accccacatgtgcttgacttcactaaatatcctgatttggaggagcgtcgaagatttgca
catgcgtatttgagttcttcgggtgaacaacctagtgacactgaagtggagcagttgctt
gatgacattgagaaatatgcacnnnnnnnnnnnnaaacctggctagctacggccgggatc
caggaacatgtaaataaaattgactttgactacaaggagtatgcgaaacagaggcttcaa
gagtactggtcaaggaaaacttgtcttttgggctctcatgagtactcttcccatgataat
gcgactaaggttaatggggagcaaacactaacatcaaccactaacagaaagccagctaag
aggaatagtgtctccaataaattgaagaaaatctttggtcttggctttttcagatcgaaa
cactag

DBGET integrated database retrieval system