KEGG   Glycine max (soybean): 100816150Help
Entry
100816150         CDS       T01710                                 

Definition
delta-1-pyrroline-5-carboxylate synthase-like
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
gmx  Glycine max (soybean)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gmx01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gmx00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 713 aa AA seqDB search
MADRSRSFMKDVKRVVIKVGTAVVTREEGRLAVGRLGALCEQIKQLNSLGYDIILVSSGA
VGIGRQRLRYRKLINSSFADLQKPQLELDGKACAAVGQNSLMALYDILFTQLDVTSAQLL
VTDNDFRDEDFRKQLTETVKSLLSLKVIPVFNENDAVSTRKAPYEDSSGIFWDNDSLSAL
LALELKADLLVLLSDVEGLYSGPPSDPHSKLIHTYIKEKHQNEITFGDKSRVGRGGMTAK
VKAAVHAADAGIPVVITSGFAAENIINVLQGQRIGTLFHKDAHEWVQVKEVDAREMAVAA
RECSRRLQAISSEERKQILLKIADDLEANEKIIRTENEADVAVAQQAGYENSLVARLALK
PGKIASLANNVRIIANMEDPIGQVLKRTELSDGLILEKTSSPLGVLLIVFESRPDALVQI
ASLAIRSGNGLLLKGGKEAKRSNAILHKVITEAIPDTVGGKLIGLVTSREEIPELLKLDD
VIDLVIPRGSNKLVSQIKSSTKIPVLGHADGVCHVYVDKSANVEMARGIVLDAKLDYPAA
CNAMETLLIHKDLIEKGWLNDIVVDLRTEGVKLYGGPRASSLLNIPQAHSFHHEYSSLAC
TVEIVDDVYAAIEHINLYGSAHTDSIIAEDKEVANVFLRQVDSAAVFHNASTRFSDGARF
GLGAEVGISTSRIHARGPVGVEGLLTTRWILKGSGQVVDGDKGIVYTHKDLAA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccgttctcggagcttcatgaaggacgtgaagcgcgtggtcatcaaggtcggc
accgccgtggtgactcgcgaagagggaaggttagcggtcggaagattaggcgctctctgc
gagcagattaagcaactcaactctctcggatacgacattattcttgtctcctccggcgcc
gtcggcatcggccgccaacgactccgctaccgcaaattgatcaacagtagcttcgccgac
cttcaaaaaccccaactcgaactcgacggcaaggcatgcgccgccgtcgggcagaacagt
ctcatggctctctatgatattctcttcactcagctcgatgtgacgtctgctcagcttctt
gtgacggataacgattttcgagatgaggatttcaggaagcaacttactgagaccgtgaaa
tcgttgttatcgcttaaggttattccggtgttcaatgagaacgatgctgtcagtactagg
aaggctccctatgaggattcttctggtatattttgggataatgatagtttatctgctctg
ttggccttggagttaaaagccgatcttcttgttttgttgagtgatgtagaaggtctttat
agtggccctccaagtgacccacattcaaagcttattcatacatatattaaggagaagcat
cagaatgaaattacttttggtgacaagtctagagtgggaagaggtggaatgactgccaaa
gtaaaagctgctgttcatgcagctgatgccggcattcctgttgttattaccagcggtttt
gcagctgagaatattattaatgttctccaaggacaacgtataggaactctcttccataaa
gatgcacatgagtgggtccaagtaaaagaggtcgatgctcgtgagatggcagttgcagcc
agggaatgttccagaaggctccaggccatatcttcagaagaaaggaaacaaattttactt
aaaatagctgatgatctggaagctaatgaaaaaataatcaggactgaaaatgaagctgat
gttgctgtggcacaacaagcaggatatgaaaattccttggtggctaggctagctttaaaa
cctgggaagattgcaagccttgcaaacaacgtgcgaattatcgccaacatggaagatcca
attggtcaagtattaaaacgaactgagctttcagatgggctaattttagagaagacatca
tctcctttgggagtgctccttattgtttttgagtcacgccctgatgctcttgtacagata
gcttcgctggcaatccgaagtgggaatgggcttctcttgaaaggtggcaaagaagctaag
cggtcaaatgcaattttgcacaaagtaattactgaggccataccagatactgttggtgga
aaacttataggacttgtgacctcaagggaagaaatccctgagctacttaagctggatgac
gtaattgatctggtgattccaagaggcagcaacaaacttgtttctcaaatcaagagttcc
actaaaattcctgttttaggtcacgctgatggagtttgccatgtctatgttgataagtct
gctaatgtggagatggcgagggggattgtacttgatgcaaaattagattatccagcagcc
tgcaatgccatggaaacacttcttatccacaaggatttgatagagaaaggttggctaaat
gatattgttgttgacctacgaactgaaggtgttaaattatatggaggaccaagggcaagt
tctctgttaaatattccacaagcacattcatttcatcatgagtacagttcgctggcttgc
actgttgaaattgtggatgacgtgtatgcagctattgaacatataaatctttatggaagt
gcacacactgattccatcattgcagaagataaagaagttgctaatgtgtttctacgccaa
gtagacagtgctgctgtttttcacaatgcaagcaccagatttagtgatggggcacgattt
ggactgggcgcagaggttggaattagtacgagcaggattcatgctcgaggtccagtaggt
gttgagggattgttaacaacaagatggatactaaaaggaagtggacaagtagtagatggt
gataaagggattgtctatacccacaaagaccttgcagcttaa

DBGET integrated database retrieval system