KEGG   Glycine max (soybean): 100816351Help
Entry
100816351         CDS       T01710                                 

Definition
uncharacterized LOC100816351
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gmx  Glycine max (soybean)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100816351
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     100816351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 457 aa AA seqDB search
MGCLGDGRFAVEIRNGVSNGCGEVEDAVKVLLEGLGEDVNREGLRKTPLRVAKALREGTR
GYRQKVKDIVQGALFPEAGLDNRVGHAGGAGGLVIVRDLDLFSYCESCLLPFPVKCHVGY
VPSGERVVGLSKLSRVADVFAKRLQEPQRLADEVCSALHRGIKPAGVAIILQCTHIHFPD
IEPVFLDSNHQGWVKILVSSGSGVFENKNADVWDDFFGLLKFRGINMDKIHLRGSSDPCW
CPSQSSLSAKVSSKIGPVNPVMVTAVASIIESLGEDPLRKELIGTPSRFVKWLMNFQNSN
FDMKLNGFLCDGIDSLNANEEVNVNQKITSELNIPFWSQCEHHLLPFHGVVHIGYLMSDG
FNPMGKLLLQSIVHFYGFKLQVQERLTRQIAETIAPLLGGDVIVVVEASHTCMISRGIEK
FGSSTATIAVLGHFSTNPTARASFLESIPRPTSSGEQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggggtgtttgggtgatgggcgtttcgctgttgagattcgaaatggagtgagcaatggt
tgtggtgaagttgaggatgctgtgaaggttttgttggagggtctaggggaagatgtgaac
agggaaggtcttagaaagacaccacttcgtgttgccaaggcccttcgtgaaggaaccaga
ggttacagacaaaaggtgaaggacattgttcaaggtgctttattccccgaagctggtcta
gataatagagttggtcatgcagggggagcaggtggactcgtgattgttcgagatcttgac
ttgttttcctattgtgagtcctgcttgcttccattcccggtcaagtgtcatgtgggttat
gtcccctctggtgaaagagttgttggtttaagcaagctctctcgtgttgctgatgtattt
gcgaaacgacttcaagagcctcagcgtctggcagatgaggtatgctctgctttacatcgg
ggaataaagccggcaggtgttgctatcatacttcaatgtacacatatccactttccagac
atagaaccagtctttcttgactcaaaccatcaagggtgggtgaagatacttgtttcctca
ggttctggggtttttgagaacaaaaatgcagatgtatgggatgatttctttggtcttctt
aaatttagaggcatcaatatggataaaattcatttgagaggatcatctgatccatgctgg
tgtccttctcagtcttctctatctgccaaagtttcctcgaaaataggaccagtcaatcct
gtaatggttactgcagtagcttcaattattgaatctttgggagaagatcctttgaggaaa
gagcttatagggactccaagtaggtttgtgaaatggttgatgaactttcaaaacagtaac
tttgatatgaagttgaatggttttctttgtgatgggatagattctttgaatgccaatgag
gaggttaacgtcaaccaaaaaataacctctgagctgaacatacctttttggtcacaatgt
gagcatcatttgcttccctttcatggtgttgttcacataggatacctcatgtctgatgga
ttcaatcctatgggaaaattgcttttacaatcaatagtacatttttatggtttcaagctc
caagttcaggaaaggcttaccaggcagatagctgaaaccattgccccactgttaggcgga
gatgtgatagtagttgtagaggcaagccacacatgtatgatttcgaggggaattgagaag
tttggaagtagtacggctactattgcagtgttaggacatttttcaaccaaccctactgca
agggcatcattcttggagagtattccacgtcctacatcatctggggagcaatga

DBGET integrated database retrieval system