KEGG   Glycine max (soybean): 100816558Help
Entry
100816558         CDS       T01710                                 

Definition
serine/threonine-protein kinase TOR-like
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
gmx  Glycine max (soybean)
Brite
Protein kinases [BR:gmx01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   100816558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 2468 aa AA seqDB search
MATASQSHRYIGPPSVGPGPGDALNRILADLCTRGNPKEGASLALKKHLEEEARDISGEA
FSRFMDQLYDRISGLLDSSDVAENLGALRAIDELIDVALGENASKVSRFSSYMRIVFDTK
RDPEILVLASRVLGHLARAGGAMTADEVERQVKIALDWLRGNRVEYRRFAAVLILKEMAE
NASTVFNVHVPEFVDAIWVALRDPALPVRERAVEALRACLRVIEKRETRWRVQWYYRMFE
ATQDGLGKNAPVHSIHGSLLAVGELLRNTGEFMMSRYREVAEIVLRYLEHRDRLVRLSIT
SLLPRIAHFLRDRFVTNYLTICMDHILSVLKAPQDRDSGFIALGEMAGALDGELIHYLPT
ITTHLREAIAPRRIKPSLEALACVGSIAKAMGSAMEPHVRGLLDIMFSTGLSTVLVEALE
QISTSIPSLLPTIQGRLLDSISMVLSKSHYHLGRPAQSVGRGIIINVPQQVSELNGSALV
QLALQTLARFNFKGHELLEFARESVVVYLDDEDGATRKDAALCCCRLIASSFSGMACSHF
GSSRLTRSGGKRRILVEELVEKLLISAVADADVTVRHSIFTSLHGDRGFDEYLAQADNLS
AVFAALNDEDFDVREYAISVAGRLSEKNPAYVLPALRRHLIQLLTYLEQSADSKCKEESA
KLIGCLIRNCERLILPYTAPIHKALVARLVDVNANTGTISGVLVTVGDLARVGGFAMRQY
IPELMPLIVEALLDGAAVSKREVAVATLGQVVQSTGYVITPYNEYPQLLGLLLKLLNGEL
VWSTRREVLKVLGIMGALDPHLHKRNQKTLPGPHGDVTRSASDSSQQIQSMDEFPMDLWP
SFASSDDYYSTVAINSLMRILRDPSLASYHLKVVGSLMFIFKSMGLGCVPYLPKVLPDLF
HTVRTCEDSLKDFITWKLGTLVSIVRQHIRKYLQDLLSLISEFWSAFTLPAPARPGLGYP
VLHLVEQLCLALNDEFRTYLPVILPGCIQVLSDAERCNDYTYVLDILHTLEVFGGTLDEH
MHLLLPALIRFFKVDASVDIRRAAIKTLTSLIPRVQVTGHISSLVHHLKLVLDGKNDELR
KDAVDALCCLAHALGEDFTIFIPSIHKLLQKYRLRHKEFEEIEGRLQRREPLILGITASQ
RLNRRLPVEVISDPLDDVEIDPYEDGSDAHKLRGHQVNDGRLRTAGEASQRSTKEDWAEW
MRHFSIQLLKESPSPALRTCARLAQLQPFVGRELFAAGFVSCWAQLNETSQKQLVRNLEM
AFSSPNIPPEILATLLNLAEFMEHDEKPLPIDIRLLGALAEKCRAFAKALHYKEMEFEGA
RSKKMDANPVAVVEALIHINNQLHQHEAAVGILTYAQQHLDFQLKESWYEKLQRWDDALK
AYTAKASQATSPHLVLDATLGKMRCLAALAQWDELNILCKEFWTPAEPAARLEMAPMAAN
AAWNMGEWDQMAEYVSRLDDGDETKLRGLGNTAASSDGSSSGTFFRAVLLVRRGKYDEAR
EYVERARKCLATELAALVLESYERAYSNMVRVQQLSELEEVIDYRTLPTGDQVAEERRAL
IRNMWTQRIEGAKSNVEVWQALLVVRALVLPPVEDVETWLKFASLCRKSGRISQAKSTLV
KLLQYDPEKSPENVRYHGPPQVMLAYLKYQWSLGEDSKRREAFIRLQNLAMELSSAPSIQ
PVTPSSFTNGLNPSVPLLARVYLNLGSWQWSLSPGLVDESIKDILNAFTKATQYANKWAK
AWHKWALFNTAVMSHYTLRGFPDVAAQFVAAAVTGYFHSIACAANSKGVDDSLQDILRLL
TLWFNHGATAEVQMALKKGFSLVNINTWLVVLPQIIARIHSNNHAVRELIQSLLVRIGQN
HPQALMYPLLVACKSISNLRKAAAQEVVDKVRQHSGVLVDQAQLVSKELIRVAILWHEMW
HEALEEASRLYFGEHNIEGMLNVLEPLHEMLEEGAMKNNVTIKERIFIEAYRQELLEAYE
CCMNYKRTGKDAELTQAWDIYYHVFRKIDKQLQSLTTLDLESVSPELLECRNLELAVPGS
YRADAPVVTIASFARQLVVITSKQRPRKLTIHGSDGDDYAFLLKGHEDLRQDERVMQLFG
LVNTLLENSPKTAEKDLSIERYAVIPLSPNSGLIEWVPNCDTLHHLIREYRDARKITLNQ
EHKCMLSFAPDYDHLPLIAKVEVFEHALNNTEGNDLARVLWLKSRTSEIWLERRTNYTRS
LAVMSMVGYLLGLGDRHPSNLMLHRFSGKILHIDFGDCFEASMNREKFPEKVPFRLTRML
VKAMEVSGIEGNFRSTCENVMQVLRTNKDSVMAMMEAFVHDPLINWRLFNFNEVPQMSML
TSNHVPPVVNTEESAPNRELPHPQRGARERELLQAVNQLGDANEVLNERAVVVMARMSNK
LTGRDFSTCSSVSNNSPQHAVDHSSLISGDTREVDHALSVKLQVQKLIIQASSHENLCQN
YVGWCPFW
NT seq 7407 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgcgtctcagtcccaccgttacataggccctccctccgtcggacccggaccg
ggcgacgctcttaaccgcatcctcgccgacctctgcacccgcggcaatcccaaggagggt
gcttctcttgctctgaagaagcatctagaggaagaagctcgtgacattagtggcgaagcc
ttttcgcgtttcatggatcagttgtatgacaggatctccggccttttggacagcagcgac
gttgccgagaatctgggagctctgagggctattgacgagttgattgatgtggcgcttggg
gagaatgcttctaaggtctccagattttccagctacatgcgtattgtcttcgacaccaaa
cgcgatcccgagattctcgttcttgctagtagggttctcggtcaccttgctagggctggg
ggagctatgactgctgatgaagtcgaacgccaggttaaaattgctctcgattggcttcga
ggaaatagagtcgagtaccgtcgatttgctgctgttttaatcttgaaagaaatggcagaa
aatgcttcgactgttttcaatgtccatgtgccggaatttgtcgatgctatctgggttgct
ttgagagatccagcgttgccagttcgtgagcgggctgtggaggcactgcgagcttgcctt
cgtgttattgaaaagcgtgagacacgatggcgcgtgcagtggtactatcgaatgtttgaa
gcaacacaagatggattgggtaaaaatgcacccgtgcacagcatacatggttcactgctt
gccgttggagagcttttgaggaatactggcgagttcatgatgtcaagataccgcgaagtt
gctgaaattgttctcagataccttgagcaccgggatcggctagttcgcctgagcataact
tcattgctgcctcgtattgcccattttctacgtgatcgttttgtcacaaactacttaact
atatgcatggatcatattctttctgtcttgaaagcaccacaagatcgtgatagtgggttc
attgctctgggagagatggctggggcactggatggggaactaatacattacttgccgaca
ataactactcacttacgtgaggcgattgctccacgtaggatcaaaccttcacttgaggca
ttggcttgtgttggaagtattgctaaagcaatggggtcagcaatggaacctcatgtacgt
ggacttttggatattatgttttctactggcctttctactgtacttgtggaagcccttgag
caaataagtaccagcattccgtctctgctgccaaccattcaaggccgattgctagacagc
atatctatggttctttctaagtcgcattatcatttggggaggcctgcacaaagcgtgggt
agagggataataataaatgtccctcaacaagtctcagagcttaatggttctgctcttgta
caacttgctttgcagactcttgcccgttttaactttaagggccacgaactacttgaattt
gctagagagtcagttgttgtctatttggatgatgaggatggagctacgcgaaaagatgca
gctctatgttgttgcagattgattgcgagttctttctctggtatggcatgctcacatttt
ggttctagcaggttgactcgatcaggggggaagcgccggatccttgttgaggagcttgtt
gagaagcttctcatttctgctgttgcagatgctgatgttactgttcggcattctatcttt
acttctctccatggagatagaggttttgatgagtatttggcccaggcagacaacctgagt
gcagtatttgctgctttaaatgatgaggattttgatgttagagagtatgcaatttctgtg
gctggaaggttatcagagaaaaatcctgcatatgttcttccagctcttcgtcgccatctt
atacagttgttaacttacttagagcagagtgcagatagcaaatgcaaagaagaaagtgca
aagttaattggttgtttgataaggaattgtgaacggctaatacttccatacactgctcca
attcataaggcactcgtggccagacttgttgatgttaatgccaatactggaaccattagt
ggagtccttgtaactgtgggggatcttgcgagggtgggcggttttgcaatgaggcaatac
attcctgaacttatgcctttaattgttgaagctttattggatggagctgctgtctccaaa
cgtgaagtggctgttgctacactaggtcaagttgtgcagagcacggggtatgttataact
ccatataatgagtatccacaattacttgggttactcttaaaattactgaatggtgaacta
gtatggtccaccagacgtgaagtattgaaggttcttggcatcatgggtgctctggatcct
catttgcataaacgaaatcaaaaaaccttgccagggcctcatggagacgtcacccgctct
gctagcgattcaagtcaacagattcagtctatggatgaatttcccatggacctttggcct
tcttttgcttcatcagatgactattactccacggttgcgattaattctctcatgcgaata
ttgagggatccatcacttgctagctatcacttaaaggtggttgggtctcttatgttcata
ttcaagtcgatgggacttggctgcgttccctacctgccaaaggttttgcctgatcttttt
catactgttcgtacatgtgaagatagtttaaaggactttataacatggaagcttggaact
ctggtgtctattgtgcgccagcacattcgtaaatatttgcaagatttgctatctttaata
tctgaattttggtcagcattcactcttccagcaccagctcgtcctggtcttggctatcca
gttcttcacctggtggaacagctttgcttggctcttaatgatgaatttagaacatatctt
ccagttattctgccaggttgtattcaggtccttagtgatgcagaacggtgcaatgactat
acttatgttcttgatatccttcatactcttgaagtgtttggtgggactttggatgagcat
atgcatctacttcttcctgctctaatacgattttttaaagtggatgcctcagtagacata
agacgtgctgcaattaaaactttgacaagcctgatccctcgtgttcaggtcactggtcat
atatcctctcttgtgcaccacttgaagttagttttggatgggaaaaatgatgagctccga
aaggatgctgtagatgcactttgttgtttggctcatgctcttggcgaggatttcacaatt
tttattccatcaattcacaaacttctacagaaatatcgcttgcggcacaaggaatttgag
gaaattgaagggcgtttacagcgacgggagccacttattcttgggatcacagcttcacaa
agactgaacagacggcttcctgttgaggtcattagtgatcctttagatgatgtggagatt
gatccttatgaagatggatcagatgctcacaaacttagaggccatcaggttaatgatggt
cgattacggacagctggggaggcttctcagcgaagtactaaggaagattgggcagaatgg
atgaggcattttagcattcaacttctaaaggagtctccttctccagctttacgaacctgt
gctaggcttgcacagttgcagccttttgttgggcgagagttatttgcagctggatttgtc
agttgttgggcgcagctaaatgagactagccagaaacaactagttcggaatctagagatg
gcattttcatctccaaatatccccccagaaattttggcaacacttcttaacttggctgag
ttcatggagcatgatgagaaacctcttcctattgacatacgccttcttggtgctcttgct
gagaagtgtcgtgcatttgcaaaagccttacactataaagaaatggaatttgaaggagca
cgttccaagaagatggatgctaacccagttgctgtagttgaagctcttattcatataaac
aaccaattacaccaacatgaggctgcagttggaatactaacctatgcccaacagcatcta
gattttcaacttaaggagtcatggtatgagaaactgcagcgatgggatgatgccctcaag
gcttatacagcaaaggcttctcaagcaacaagtccacatcttgtcttggatgccacttta
ggtaaaatgagatgccttgctgcattggctcaatgggatgagttgaatatcctatgcaaa
gaattttggaccccggcagagccagctgctcgtcttgaaatggcaccaatggctgcaaat
gctgcttggaacatgggagaatgggaccaaatggcagaatatgtgtctcgattggatgat
ggtgacgaaacaaaacttcgaggtttggggaacactgctgccagtagtgatggaagtagt
agtggtactttcttcagggctgttctattggttcgtagaggaaagtatgatgaagcacgc
gagtatgtagaaagagctagaaaatgtctggcaacagagcttgctgctctggttttggag
agttatgaacgtgcttacagtaatatggttcgtgttcagcaactatcagaactagaagag
gttattgattaccgtacacttcctactggagaccaagtagcagaagagcggcgggctctt
attcgcaacatgtggactcagcgtatagaaggagccaaaagcaacgttgaggtttggcag
gctcttttggttgttagagcacttgtgctgcctcctgtggaagatgttgaaacctggctc
aaattcgcctctctttgcagaaaaagtgggcgcattagtcaagcaaaatctacattagtt
aaacttctacagtatgaccctgaaaagtctcctgaaaatgttcgataccatggccctcct
caagtaatgctagcatacttgaagtaccagtggtcccttggagaggattcaaagcgcagg
gaagcatttataaggcttcagaatttggctatggaactctcaagtgcacccagcattcaa
ccagttacaccatcgagcttcacaaatggtttgaatcctagtgttcctctccttgctcgt
gtttatctaaatcttggctcctggcagtggtcactttctcctgggcttgttgatgaatcc
attaaagatatacttaatgcattcacaaaagctactcagtatgcaaataaatgggccaaa
gcttggcataaatgggcattattcaacacagcagtgatgtctcattatactttaagagga
ttccccgatgttgcagcacaatttgttgctgcagctgtcactggatactttcattctata
gcatgtgcagcaaattccaaaggtgttgatgatagtttacaggatattcttcgacttttg
acattatggttcaaccatggagctacagcagaagtacaaatggccctaaagaaaggattt
tccctagttaacatcaatacttggctagtagttctacctcaaataattgccaggatacac
tctaataaccatgctgtgagagagttgatacagtcacttttggttcggattgggcaaaat
catccacaggctctcatgtatcctttgcttgtggcctgtaaatcaataagcaacttacgt
aaagctgcagctcaggaagttgttgacaaagttcggcagcatagtggtgtactagtggat
caggcgcaacttgtatcaaaggaactgatcagagttgccattctttggcatgaaatgtgg
catgaggcactggaagaagctagccgtttgtattttggtgagcataatattgaagggatg
ctaaatgtgttggagccattgcatgaaatgcttgaagaaggagcaatgaaaaacaacgtc
accataaaggagagaatatttattgaggcttatcgacaggaattattagaggcttacgag
tgctgtatgaattataagagaactgggaaagatgctgagctgacccaggcttgggatatc
tattatcatgttttcagaaagatagataaacaacttcaaagtctgacaactttagacttg
gagtctgtttctccagaattgctagaatgccgcaatttggagcttgctgttcccgggtca
taccgtgctgatgcaccagtggttacaattgcatcatttgcacgccaacttgttgtcata
acatctaagcaacgacccaggaagttaaccattcatgggagtgatggtgatgattatgcc
ttcttgttgaagggacatgaggatttacgccaggatgaacgagttatgcagctttttggt
ttggtgaatactctccttgagaattctcccaaaacagcagagaaagatctgtctattgag
cgatatgctgtaattcctttgtctccaaacagtggtttaattgaatgggtcccaaattgt
gacactttgcatcatcttattcgggagtatagagatgccagaaagatcactttgaatcag
gaacacaaatgcatgctcagttttgcacctgattatgatcatttgcctcttatagctaaa
gtggaggtgtttgaacatgctttgaacaatacagaaggaaatgacctagcaagggtactt
tggttgaaaagtcgaacatcggagatatggcttgagaggaggacaaattatacgaggagt
ttggcagttatgagcatggttggttaccttcttggtttaggtgatcgccatccgagcaat
cttatgttacaccggtttagtgggaagattttacacatagattttggagactgttttgaa
gcatcaatgaaccgtgagaagttcccggagaaggttcctttccgcttgacaagaatgctt
gtgaaagccatggaagttagtggtattgagggaaacttccgctcaacttgtgaaaatgtt
atgcaagttttgcgaacaaataaagatagtgttatggccatgatggaggcctttgtacat
gatcctctcataaattggcgtctttttaacttcaatgaagttccacaaatgtctatgctt
accagcaatcatgtacctcctgttgtaaatactgaggaatctgccccgaatagagagctt
ccccaccctcagcgtggtgcccgtgaaagggaacttctacaggctgttaaccaacttggt
gatgctaatgaggttctgaatgaacgtgctgtggttgtcatggctcgcatgagtaataag
cttacaggacgggatttttcaacttgttcttcagtatcaaacaactcccctcagcatgct
gtggaccatagcagtttaatttctggagacactcgtgaagttgatcatgctttatctgtg
aagttgcaagttcaaaagttaataatccaagcttcctcgcatgaaaatttgtgccaaaac
tacgtagggtggtgccctttctggtaa

DBGET integrated database retrieval system