KEGG   Glycine max (soybean): 100816614Help
Entry
100816614         CDS       T01710                                 

Definition
magnesium-chelatase subunit ChlD, chloroplastic-like
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gmx00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 750 aa AA seqDB search
MGFALAYTASGCCSNLQFQSLLFAAASLRSKPCLSLCNSTYRPKRILQRSPIVGAQSENG
ALVTSEKPDTNYGRQYFPLAAVVGQDSIKTALLLGAIDPGVGGIAISGKRGTAKTVMARG
LHAILPPIEVVEGSIANADPTCPEEWEDGLTECLEYDSTGNIKTRIIKSPFVQIPLGVTE
DRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYVDEINLLDEGISNLLLNVLTEGVNTV
EREGISFKHPCRPLLIATYNPEEGAVREHLLDRIAINLSADLPMSFENRVAAVGIATEFQ
ENSSQVFEMVEEETDNAKTQIILAREYLKDVTLNREQLKYLVIEALRGGCQGHRAELFAA
RVAKCLAALEGREKVYVDDLKKAVELVILPRSIVTENPPDQQNQPPPPPPPPQNQESGEE
QNEEEEQEDDKDEENEQQQEQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGRAGRAKNVI
FSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRRAKDSGNNRKVFVEKTDMRAKRM
ARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDAAEVLLPP
SRSISMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGRIMIVAITDGRANISLK
RSTDPEAAAATDAPKPSAQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAKEIARV
AQGKYYYLPNASDAVISSATKEALSALKSS
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcgctttggcatacacagcatctggttgttgctcaaacctacaatttcagtct
ctgttattcgctgctgcttcattgagatcaaaaccgtgtctctctctctgcaactctact
tatcgacccaaacgcattctccagcgttctccaattgttggcgctcagtctgaaaatgga
gctctggttacttcggagaagcccgacactaattacggaagacaatacttccccctcgct
gctgttgtaggccaagattctataaaaactgctcttttacttggtgcaattgaccccggg
gttggaggaattgccatatcaggaaagcgaggaactgccaaaactgtaatggcacgtgga
ttgcatgcaatactgcctcctattgaagtggtagaaggttccattgccaatgcggatcca
acctgcccagaagagtgggaagatggtcttacagaatgcctggaatatgattctactgga
aatattaaaactcgtattatcaagtctccctttgttcagattcctcttggagtcacagag
gacagactcattggatcggttgatgttgaggagtctgtgaaaacaggcacaactgttttc
cagcctggtttacttgcagaagctcatagaggtgttttatatgttgatgaaattaatctt
ttggatgagggtatcagtaatttgctcctcaatgtattgactgaaggagtaaacactgtt
gaaagagaggggatcagtttcaagcacccttgcaggccccttctcattgccacctataac
ccagaagagggtgctgttcgtgaacatctgctggatcgcattgcgattaatttaagtgca
gatcttccaatgagttttgaaaaccgtgttgcagctgttggaattgccacagagtttcag
gagaacagtagccaagtatttgagatggtcgaagaggaaacagacaatgcaaaaactcag
atcatcttagccagagagtatctaaaagatgttactcttaacagagaacaattaaaatac
ctggttattgaagctttacggggcggttgccagggacatagagctgagctatttgctgcc
cgtgttgcaaagtgcttagctgctttggagggacgtgaaaaggtttatgtggatgaccta
aaaaaagctgtagaattggtcattctaccccggtcaatcgttactgagaacccaccagat
caacaaaaccagcctcctccccctccgcctcctccacaaaatcaagaatcaggcgaagaa
cagaatgaagaggaagaacaagaggatgacaaggatgaagagaatgaacaacagcaagaa
caattacctgaagagtttatctttgatgctgaaggtggcttggtagatgaaaaactcctc
ttctttgcccaacaagcacagagacgccgtgggagggctggaagggcaaaaaatgttata
ttttccgaggatagaggccgatacatcaagcccatgcttccaaagggccctgtaaagaga
ttagctgtagatgcaacccttagagctgctgcaccttatcaaaaattgcgaagggcaaaa
gattctggaaacaatagaaaggtatttgtggagaaaacggacatgagggcaaagagaatg
gcacgtaaggcaggagcattggtgatatttgttgttgatgcaagtggaagcatggcattg
aacaggatgcagaatgcaaaaggtgcagcacttaagcttctggctgaaagttatacaagc
agggatcaggtatctataattccattccgtggagatgcagctgaagttctcctgccacct
tctagatcaatttcaatggcaaggaaacgtcttgaaaggcttccatgtggtggagggtcc
ccacttgctcatggtcttacaacggctgttagagttggactaaatgcggagaaaagtggt
gacgttggacgtataatgattgttgcaatcactgatggcagagccaatatatcattgaaa
aggtcaactgaccctgaagctgccgcagctactgatgccccaaaaccttcagcacaagaa
ttgaaggatgaaattcttgaggtggccggaaagatatataaagcaggaatgtctctcctt
gtcatcgacactgaaaataagtttgtctcaacgggttttgccaaggagattgctagagtt
gcccaagggaagtattattatctgccaaatgcttcagacgctgttatctcatcggcaaca
aaggaagctttatcagctttgaaaagttcatga

DBGET integrated database retrieval system