KEGG   Glycine max (soybean): 100816664Help
Entry
100816664         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Organism
gmx  Glycine max (soybean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 808 aa AA seqDB search
MTIEPMDLLRSYLSRVRIPEPTNRIYKHECCISFDSPRSEGGLFIDMCTFLAFGKDFVGW
NYEKTGNPVYLHIKQTKKLVPEDRPSKKPTLLAIGVDGGFDNNEPEYEETHSVVILPEYV
SLPFPSVELPEKVRLAVDAIVLAEGTERKEQLAAWTADKKKVSSYATNLQQIDNGVVIPP
SGWKCAKCDKADNLWLNLTDGMILCERKNWDGTGGNNHAFEHYQETGYPIAVKLGTITAD
LEAADVYSYPDDESVLDPQLAQHLAFFGLDFSSLRKTEMTTAERELDHNTNFDWNRIQES
GQEVDPIFGPGYTGLVNIGNSCYMAATIQVVFSTRSFTSRYYLNQSLKKAFEMSPADPTV
DLNMQLTKLAHGILSGKYSVPAFENDEKENVATSTRTAKQEGIRPHMFKSVIAASHPEFS
STQQQDALEFFLHFLDQVERANTGKTELDPSRSFKFGIEDRILCSSGKVTYNRRNDYILS
LNIPLHEATNEEELESFHKLKAEKLAEGKEINANEIVRPRVPLETCLVNFSAPEEIQDFY
STALKAKTTALKTAGLTSFPDYLVLHMRRFVMEAGREPKKLDVHIDVPDIIDISHMRSKG
QQSGEELLPDGVPGEQDSNKISANEEIVAQLVSMGFNHLHCQKAAINTSNVGVEEAMNWL
LSHMDDPDIDNPISKGHGSETIVDQSKVDILISFGFEEEIARNALKASGGDIEKATDWIF
NNPDASVSSMDASPSNAESTTNDVNLPDGGGKYRLMGILSHSGTSLQCGHYVAHILKDGR
WAIFNDNKVGASIDPPKEMGYLYFFERL
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaacccatggatttgctccgctcctatctctcccgggttcggatccccgaa
cccaccaatcgcatctacaagcacgaatgctgcatttccttcgactctccgaggtcagaa
ggtggtttgttcattgacatgtgcacttttcttgcttttgggaaagattttgttggttgg
aattatgagaagactggaaatcctgtctatttgcatataaagcagacaaagaagttagtt
ccagaagacaggccttcaaagaaacctactctcttggctataggtgttgatgggggattt
gataacaatgagcctgaatatgaggaaacacatagtgtagttatattacctgagtatgtt
tctcttccattcccttctgtggaattgccagagaaggtaaggttggcagttgatgcaatc
gtactagctgagggtactgaacgaaaggagcaacttgcagcttggactgctgataagaaa
aaagttagttcctatgcaacgaatttacaacagattgacaatggtgttgttattccgcca
tctgggtggaaatgtgctaaatgtgacaaggcagacaatctatggctaaacctgactgat
ggaatgattctttgtgagaggaaaaactgggatggaactggtggaaacaaccatgctttt
gagcattaccaagagacaggctaccctattgctgtaaagcttgggactatcactgctgat
ctggaagcagcagatgtttactcttatccagacgatgaaagtgtcttggatccacaatta
gcacagcatctggcattttttggccttgacttttcatcactacgaaagactgaaatgaca
actgctgaaagagaacttgatcacaatacaaattttgattggaatcgaatccaagaaagt
ggacaagaagtagatccaatttttggacctggatatacaggattggtcaatattggaaac
agttgttacatggcagcaactattcaagttgtgttttcaacaagatccttcacatcacgg
tactatttgaaccaaagtctaaagaaggcatttgagatgtctcctgctgatcccactgta
gacctaaatatgcagctaacaaaattggctcacggcatactttctggtaaatattctgtt
ccggcatttgagaatgacgaaaaagaaaacgttgctacttcaactagaactgctaaacaa
gaagggatacgtccacatatgtttaaatctgtaatagctgccagccatcctgaattttca
tctacgcagcaacaggatgctttagaatttttcctacattttcttgatcaagttgagcga
gctaatactgggaaaactgaactggatccatcgaggagtttcaaatttggtattgaagat
agaattttgtgttcatctggaaaagttacatataatagaaggaatgactacattctttcc
ctcaatatcccattacatgaggcaactaatgaagaagaattagaatcctttcacaaactg
aaagcagagaaacttgcagaaggaaaggaaataaatgccaatgagattgtgcgcccaagg
gtacctttagaaacttgccttgtgaacttctcagctcctgaggagatacaagatttttac
agtactgctttgaaggcaaagacaacagcactgaagactgcaggtctgacctcatttcct
gattacctggtgttacatatgcggaggtttgttatggaggcaggacgggaacctaaaaag
cttgatgtgcacattgatgttcctgatatcatagatatcagtcacatgcgcagcaaaggt
cagcagtctggggaagagctattacctgatggtgttcctggagagcaagattctaacaaa
atttcggccaacgaagaaattgttgcccagctggtttccatgggctttaaccatctccat
tgtcagaaagctgctataaatacatcaaatgttggagtagaagaggcaatgaattggttg
ttatctcacatggatgatccagacattgacaatcctatttccaaaggccatggctctgag
acaattgttgaccaatcaaaagttgatattctaatttcttttggatttgaagaagaaatt
gctaggaatgctctgaaggcatcgggtggtgacattgagaaagcaacagattggatattt
aacaatcctgatgcatcagtctccagtatggatgcttccccatcaaacgctgaatccact
accaatgatgttaacctacctgatggaggagggaaatatcgacttatggggattttgagc
cacagtggaacctctttgcagtgtggtcactatgttgctcacattttaaaagatggaaga
tgggcaattttcaacgacaacaaggtcggggcatccattgatcctccaaaggaaatgggc
tatctttatttcttcgagaggctttga

DBGET integrated database retrieval system