KEGG   Glycine max (soybean): 100816744Help
Entry
100816744         CDS       T01710                                 

Definition
phospholipase A(1) DAD1, chloroplastic-like
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
gmx  Glycine max (soybean)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:gmx00564]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:gmx00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 430 aa AA seqDB search
MRTLHNYTPTLTRPQCTTLVQSTKPLQKMEKMMNMPQLRSSSLPPLSKKVGKRWKEYQGM
NNWDGLLDPLDENLRAEILRYGHFVEAAYKSFEFDPSSPNYATCKFPKNTLFEKSGLHNT
GYKVTKHLRATSGIKLPSWVDKAPSWVAAQSSYVGYVAVCNDKEEIKRLGRRDIVVAYRG
TTTCLEWLENLRATLTHVSVPSITTETTTEPCSMEENGAMVESGFLSLYTSTVSNNKSFM
SLQDMVRKEIGRIRKTYQGENLSLTITGHSLGAALATLTAYDIKNSFLQPPPLVTVISFG
GPRVGNRSFRRRLEEQGTKVLRIVNSDDVITKVPGFVFDDVDKTEDVAACNGGVQVAKFQ
RWIRKRAEEVQWLLYSEVGKELRLCSRDSPYLRGVNIATSHDLNTYLHLVDGFVSSTCPF
RATAKRFLQH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcttcacaactacactccaaccctcactagaccacagtgcacaaccctcgtt
caatccaccaaacccctacaaaagatggagaaaatgatgaacatgccccagttgcgatca
tcgtcgttgccgccattgtccaagaaagttgggaagagatggaaggagtaccaaggaatg
aacaattgggacggtttattggacccattggacgagaaccttcgcgctgagattcttcgc
tatggccatttcgttgaggcagcgtataagtcctttgaattcgacccttcttccccaaac
tacgccacatgcaagttcccaaagaacacactctttgaaaagtctgggttacacaacaca
ggttacaaggtaacaaaacacctacgtgcaacctcggggatcaaactacctagctgggta
gacaaagcaccaagttgggtcgcagcacaatcgagctacgttggatacgtagcagtgtgt
aacgacaaagaagagatcaaacgacttggtcgaagagacatagttgtggcgtacagagga
acgacaacatgtttagaatggctcgaaaatcttcgagccactctgacacatgtttcagtt
ccgtcgatcacaacggagaccacaacagaaccatgcagcatggaagaaaatggagcgatg
gtagaaagtgggttcttgagtttgtacacgtcaacagttagtaacaacaaatcatttatg
agtttgcaagatatggttaggaaagagattggtcggattcgtaaaacttaccaaggagag
aatttgagtttgaccataacggggcatagtttgggggcggcattggccactctcacggcg
tatgacataaagaacagtttcctccagccgccgccgctggtgaccgtgatctccttcggg
ggtccacgcgttgggaaccgaagctttcggcggcggctggaggagcaagggaccaaggtg
ttgcgcatagtgaactccgatgatgttataaccaaggtgcccgggtttgtgttcgatgac
gtggacaaaactgaggatgttgcggcatgcaatggcggtgtccaagtggcgaagtttcag
aggtggattcgaaaacgagcggaagaagttcagtggctattgtactctgaggttggaaag
gagttacgcctttgtagcagggattctccgtacctcaggggtgtcaacattgccacgtct
cacgatttgaacacctacctgcaccttgttgacggctttgtcagttccacttgtcccttt
agagccactgctaagaggttccttcagcattga

DBGET integrated database retrieval system