KEGG   Glycine max (soybean): 100816744Help
Entry
100816744         CDS       T01710                                 

Definition
phospholipase A(1) DAD1, chloroplastic-like
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
gmx  Glycine max (soybean)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100816744
   00592 alpha-Linolenic acid metabolism
    100816744
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     100816744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 430 aa AA seqDB search
MRTLHNYTPTLTRPQCTTLVQSTKPLQKMEKMMNMPQLRSSSLPPLSKKVGKRWKEYQGM
NNWDGLLDPLDENLRAEILRYGHFVEAAYKSFEFDPSSPNYATCKFPKNTLFEKSGLHNT
GYKVTKHLRATSGIKLPSWVDKAPSWVAAQSSYVGYVAVCNDKEEIKRLGRRDIVVAYRG
TTTCLEWLENLRATLTHVSVPSITTETTTEPCSMEENGAMVESGFLSLYTSTVSNNKSFM
SLQDMVRKEIGRIRKTYQGENLSLTITGHSLGAALATLTAYDIKNSFLQPPPLVTVISFG
GPRVGNRSFRRRLEEQGTKVLRIVNSDDVITKVPGFVFDDVDKTEDVAACNGGVQVAKFQ
RWIRKRAEEVQWLLYSEVGKELRLCSRDSPYLRGVNIATSHDLNTYLHLVDGFVSSTCPF
RATAKRFLQH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcttcacaactacactccaaccctcactagaccacagtgcacaaccctcgtt
caatccaccaaacccctacaaaagatggagaaaatgatgaacatgccccagttgcgatca
tcgtcgttgccgccattgtccaagaaagttgggaagagatggaaggagtaccaaggaatg
aacaattgggacggtttattggacccattggacgagaaccttcgcgctgagattcttcgc
tatggccatttcgttgaggcagcgtataagtcctttgaattcgacccttcttccccaaac
tacgccacatgcaagttcccaaagaacacactctttgaaaagtctgggttacacaacaca
ggttacaaggtaacaaaacacctacgtgcaacctcggggatcaaactacctagctgggta
gacaaagcaccaagttgggtcgcagcacaatcgagctacgttggatacgtagcagtgtgt
aacgacaaagaagagatcaaacgacttggtcgaagagacatagttgtggcgtacagagga
acgacaacatgtttagaatggctcgaaaatcttcgagccactctgacacatgtttcagtt
ccgtcgatcacaacggagaccacaacagaaccatgcagcatggaagaaaatggagcgatg
gtagaaagtgggttcttgagtttgtacacgtcaacagttagtaacaacaaatcatttatg
agtttgcaagatatggttaggaaagagattggtcggattcgtaaaacttaccaaggagag
aatttgagtttgaccataacggggcatagtttgggggcggcattggccactctcacggcg
tatgacataaagaacagtttcctccagccgccgccgctggtgaccgtgatctccttcggg
ggtccacgcgttgggaaccgaagctttcggcggcggctggaggagcaagggaccaaggtg
ttgcgcatagtgaactccgatgatgttataaccaaggtgcccgggtttgtgttcgatgac
gtggacaaaactgaggatgttgcggcatgcaatggcggtgtccaagtggcgaagtttcag
aggtggattcgaaaacgagcggaagaagttcagtggctattgtactctgaggttggaaag
gagttacgcctttgtagcagggattctccgtacctcaggggtgtcaacattgccacgtct
cacgatttgaacacctacctgcaccttgttgacggctttgtcagttccacttgtcccttt
agagccactgctaagaggttccttcagcattga

DBGET integrated database retrieval system