KEGG   Glycine max (soybean): 100816791Help
Entry
100816791         CDS       T01710                                 

Definition
ubiquitin carboxyl-terminal hydrolase 24-like
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100816791
Peptidases [BR:gmx01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100816791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 530 aa AA seqDB search
MFVFGSFTEDETRSLLSKQSFGKKEKPVEKNQLQFGSLNSVTVESNNLLNSSKASYNAPP
SDSRKCNGVKSAIDNSPEVSGTVKENGSITNISPRSTSTISVNEVEEKNVNFFTLRCEDG
PLNKFTKLSLDASEAESLKNVHTTGSGDDSAPKLPDREPQKAPNGHAVMHVKDILPRGLI
NSGNLCFLNATMQALLSCSPFVHLLQQLRTCNLPKVGYPTLTAFAEFITQFDMPSITKLK
KQDADTFESGRPFRPVMFEGVLKNFTPDVPNSISGRPRQEDAQEFLSFVMDQMHDELLKL
EGQSSSLNGSKSSLVSSVEDDEWETVGPKNKSAVTRTQSFLPSELSGIFGGQLRSLVRAK
GNRASATVQPYLLLHLDIYPDAVHTIEDALHLFSAPETLEGYRTSLTAKAGVVTARKSVQ
IVTLPKIMILHLMRFGYGSQGSTKLHKPVHFPLELVLGRDLLVSPSTEGRKYELVATITH
HGMEPSKGHYTADAQYPNGRWLRFDDQSVFAIGTNKVLHDQAYVLFYRQI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgtttgggtcatttactgaagatgaaacccgatcattgctgtcaaagcagtct
tttgggaaaaaggaaaagcctgtggagaagaatcagctgcaatttggttctctgaattct
gttactgttgagtcaaacaatctgctaaattcatcaaaagcatcttataatgctccaccc
tctgattctcggaaatgtaatggagtgaaaagtgccattgataattcacctgaagtgtca
gggacagttaaagagaatggcagcattacgaatatctcccctaggtccaccagtaccatt
agtgtaaatgaagttgaagaaaaaaatgtgaatttttttacattacgttgtgaagatggt
cccttaaacaagtttacaaagttgagcctagatgcttctgaggctgaaagcttgaagaat
gtacatacaactggcagtggggatgattctgcaccaaagttacctgatcgagagccccaa
aaggcacctaatgggcatgctgttatgcatgttaaggatatactgcctcgaggccttatc
aactctgggaatctatgttttcttaatgcaaccatgcaggctctcttgtcatgctcaccc
ttcgttcatcttttacagcaattaagaacttgcaaccttcctaaggttggatatcccaca
ttgacggcatttgctgagttcataacccaatttgatatgccaagcataactaaattaaag
aagcaagatgcagatacgtttgagtctggaaggccatttcgccctgttatgtttgaaggt
gtcctaaaaaattttactccggatgtgccaaatagcatttcaggaagaccaagacaggaa
gatgctcaggaatttctgagctttgtaatggatcaaatgcatgatgaattactgaagctt
gaaggacagtcttcaagtcttaatggtagcaaatcttctctggtttcttcggtggaagat
gatgaatgggaaacagtggggccgaagaataaatctgctgttacaaggactcaaagcttt
ctcccatcagaattaagtggtatttttggaggacaacttagaagtttggtgagagctaaa
ggaaatagagcttctgctactgttcaaccatatctcttgctccatcttgacatctatcct
gatgctgttcacacaattgaggatgcacttcacttgttttctgcaccagagactcttgaa
gggtaccgaacatcactcactgcaaaggctggtgttgtgactgcaagaaaatctgttcaa
atagtgacacttcctaaaataatgatattgcaccttatgcgttttggctacggaagccag
ggtagcaccaagttgcataagcctgtgcacttccctcttgagttggtattgggtcgtgac
ttgcttgtttcaccatctactgagggtcgaaagtatgaacttgttgctacaattactcac
catggaatggagccttcaaaggggcactacacagctgatgcccaatatcccaatggtcgg
tggctacgatttgatgaccaatctgtctttgctattggaacaaataaggtgctgcatgat
caggcatatgtccttttctacagacagatttga

DBGET integrated database retrieval system