KEGG   Glycine max (soybean): 100816963Help
Entry
100816963         CDS       T01710                                 

Definition
(RefSeq) 1,4-alpha-glucan-branching enzyme 1, chloroplastic/amyloplastic
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00500  Starch and sucrose metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100816963
Enzymes [BR:gmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     100816963
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100816963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 100816963
NCBI-ProteinID: XP_003521449
UniProt: I1JPY7
Position
3
AA seq 870 aa AA seqDB search
MVYTISGIRFPVFPSLHNLSFRGDRRTASLPVFLRNNSFSRKTLAVKSSHDSDSLSSAIA
ESDKVLIPQDQDNSASLTDQLETPDITSEDAQNLEDLTMEDEDKYNISEAASGYRQIEDG
QGSVVSSLVDVSIPAKKMSVSVGRKAKIVSDEVKPKIIPPPGAGQKIYEIDPSLLAHREH
LDFRYGQYKRLRYEIDKHEGGLDTFSRGYEKFGFQRSATGITYREWAPGAKSAALIGDFN
NWNPNADVMTKNEFGVWEIFLPNNVDGSPPIPHGSRVKIRMDTPSGIKDSIPAWIKFSVQ
APGEIPYSGIYYDPPEEEKYVFKHPLPKRPKSLRIYESHIGMSSPEPKINTYVNFRDDVL
PRIKRLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPEELKSLIDRAHELGLLVL
MDIVHSHASNNTLDGLNMFDGTDGHYFHPGSRGYHWMWDSRLFNYGSWEVLRYLLSNSRW
WLDEYKFDGFRFDGVTSMMYTHHGLEVAFTGNYNEYFGFATDVDAVIYLMLTNDVIHGLF
PEAVTIGEDVSGMPTFCLPTQDGGVGFDYRLHMAIADKWIEILKKNDEDWKMGDIVHTLT
NRRWLEKCVAYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPIIDRGIALHKMIRL
ITMGLGGEGYLNFMGNEFGHPEWIDFPRGDQHLPTGVIVPGNNNSFDKCRRRFDLGDADY
LRYRGMQEFDQAMQHLEEKFGFMTAEHQYISRKNEGDKIIVFERGNLIFVFNFHWNNSYS
DYRVGCSTPGKYKIVLDSDDALFGGFSRLNHTAEYFTSEGWYDDRPRSFLIYAPSRTAVV
YALADDVEPTLADEAEPALADEAEPEPVDP
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggtttacaccatctcgggaattcgatttccggtttttccttcgctgcacaacttgagc
ttccgtggcgatcgcagaactgcgtctcttcccgtttttctccgaaacaactccttctct
cggaaaacccttgctgtaaaatcttcccatgattctgattccttgtcttctgcgattgcc
gaatctgataaagtacttattcctcaagatcaagataactctgcatccttgacagatcaa
cttgaaactcctgatataacctcagaggatgcacagaatttagaggatttaaccatggaa
gatgaggataaatacaacattagtgaagcagctagcggttacagacagattgaagatgga
cagggctctgttgtatcatcacttgtagatgtgagcattccggccaagaagatgtcggta
tctgttggtaggaaagcaaagatagtaagtgatgaagttaaacctaagatcattccccca
cctggcgctgggcagaaaatatatgagatagatccatctttgctagctcaccgtgagcat
cttgatttccgttatggacaatacaaaagattgcgttatgaaattgacaagcatgaaggc
ggtctggatacattttcacgtggttatgaaaaatttggcttccaacgcagtgctacaggc
attacttacagagagtgggcacctggagctaagtcggcagcattaattggagacttcaac
aattggaatccaaatgcagatgtaatgaccaagaatgaatttggtgtgtgggagatcttc
ttgccgaacaatgtggatggttcaccaccaattcctcatggttctcgggtcaagatccgc
atggatacgccctctggaatcaaggactcaattcctgcttggattaagttttctgtacag
gcacctggtgaaattccatatagcggaatatactatgatcccccagaagaggaaaaatat
gtcttcaaacatccactgccaaagagaccaaaatcacttagaatatatgagtcacacatc
ggaatgagtagtccggagccaaaaatcaacacatatgtcaattttagagatgatgtattg
cctcgaattaaaaggcttggctataatgctgtccagattatggctatccaagaacattct
tattatgcaagctttgggtaccatgttacaaatttcttcgcacctagcagcagatttgga
actccagaggaacttaagtctctgatagacagagcccatgaactgggtctgcttgttctg
atggatattgtacacagccatgcatcaaataatacattggatgggctgaacatgtttgat
ggaactgatggtcattacttccatcctgggtcacgaggttatcattggatgtgggattct
cgcctttttaactacggaagctgggaagttctaaggtatctactctcgaattcaagatgg
tggctggatgaatacaagtttgatggatttcgatttgatggtgttacatcaatgatgtac
actcatcatggattggaggtagcatttactggaaattacaatgagtattttggttttgca
actgatgttgatgctgtgatttacctgatgctgactaatgatgtcattcatgggctgttc
cctgaggctgttacaattggtgaagatgtgagtggaatgccaacattctgccttcctacg
caagatggtggggttggctttgattatcgcctgcacatggccattgcagacaagtggatt
gagattctcaagaagaatgatgaagactggaaaatgggtgatattgtccacacattaaca
aacagaaggtggctggaaaaatgtgtagcttatgctgaaagtcatgaccaggccttggtt
ggtgacaagacaattgcattttggttgatggacaaggatatgtatgacttcatggcttta
gacagaccatccacacctattatagatcgtggtatagcgttgcacaaaatgattaggctt
attaccatgggtcttggtggtgaagggtatttaaattttatggggaatgaatttggccat
cctgagtggattgattttccaaggggtgatcaacatcttcctactggcgtaatagttcca
gggaataacaacagttttgataaatgcaggcgtagatttgacttgggtgatgcggactat
ctaagatatcgagggatgcaagaatttgatcaggccatgcagcatctagaagaaaagttt
ggtttcatgactgctgagcaccaatatatttcacggaaaaatgaaggtgacaaaattata
gtcttcgaaaggggcaacctcatctttgtcttcaattttcattggaacaacagctattca
gattacagagttggctgttcaacccctgggaaatataagattgtcttggattcagatgat
gccttgttcggtggcttcagtcggctcaatcacactgctgagtacttcacctcagaagga
tggtatgatgaccgacctcgatcctttcttatctatgcaccttctagaacagcagtggtt
tatgcccttgcagatgatgttgaacctaccctagcagatgaagctgaacctgccctagca
gatgaagctgaaccagagccagttgatccttga

DBGET integrated database retrieval system