KEGG   Glycine max (soybean): 100817453Help
Entry
100817453         CDS       T01710                                 

Definition
(RefSeq) eukaryotic translation initiation factor NCBP
  KO
K03259  
translation initiation factor 4E
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100817453
Messenger RNA biogenesis [BR:gmx03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100817453
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100817453
Translation factors [BR:gmx03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100817453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 231 aa AA seqDB search
MDFTVEKKESENNAENAHPTTLDSSSQLASALDSNNKEIEERQARELKAGLHPLKHKFVF
WYTRRTPGVRNQTSYEDNIKKIVEFSTVEGFWVCYCHLARPASLPSPTDLHLFKEGIRPL
WEDSANCNGGKWIIRFKKVVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDILSVW
NRNASDHQAVMALRDSIKRHLKLPHSYVMEYKPHDASLRDNSSYRNTWLRG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggatttcacagtggagaagaaggaatcagagaacaacgccgaaaatgctcacccaaca
acgttagattcttcttctcaattggcatcggcacttgattccaacaacaaagaaatcgaa
gaacgacaagctcgtgaactcaaagccggacttcaccccctaaagcacaagtttgtcttc
tggtacactcgtcgaacacctggagttcgaaatcaaacatcatatgaggacaacataaag
aaaattgttgaatttagtacggttgaaggattttgggtctgctactgccatcttgctcgt
cctgcttctttacctagtccaacagatttgcaccttttcaaggaaggaatccgtcctcta
tgggaggactctgctaactgcaatggtggtaaatggattatacgattcaaaaaggttgtc
tctggccgtttttgggaggacctggttcttgccttggtgggtgaccaattggattatggg
gataacatatgtggtgcagtactaagcattcgtttcaacgaggatatattgagtgtctgg
aatcgcaatgcttcagaccatcaggctgtaatggctctgagagattcaatcaaacgtcac
ttaaagcttcctcacagctatgttatggagtacaagccccatgatgcctctctgcgagac
aattcatcttacaggaacacttggttgagaggctag

DBGET integrated database retrieval system