KEGG   Glycine max (soybean): 100817453Help
Entry
100817453         CDS       T01710                                 

Definition
eukaryotic translation initiation factor NCBP-like
Orthology
K03259  
translation initiation factor 4E
Organism
gmx  Glycine max (soybean)
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100817453
Translation factors [BR:gmx03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100817453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 231 aa AA seqDB search
MDFTVEKKESENNAENAHPTTLDSSSQLASALDSNNKEIEERQARELKAGLHPLKHKFVF
WYTRRTPGVRNQTSYEDNIKKIVEFSTVEGFWVCYCHLARPASLPSPTDLHLFKEGIRPL
WEDSANCNGGKWIIRFKKVVSGRFWEDLVLALVGDQLDYGDNICGAVLSIRFNEDILSVW
NRNASDHQAVMALRDSIKRHLKLPHSYVMEYKPHDASLRDNSSYRNTWLRG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggatttcacagtggagaagaaggaatcagagaacaacgccgaaaatgctcacccaaca
acgttagattcttcttctcaattggcatcggcacttgattccaacaacaaagaaatcgaa
gaacgacaagctcgtgaactcaaagccggacttcaccccctaaagcacaagtttgtcttc
tggtacactcgtcgaacacctggagttcgaaatcaaacatcatatgaggacaacataaag
aaaattgttgaatttagtacggttgaaggattttgggtctgctactgccatcttgctcgt
cctgcttctttacctagtccaacagatttgcaccttttcaaggaaggaatccgtcctcta
tgggaggactctgctaactgcaatggtggtaaatggattatacgattcaaaaaggttgtc
tctggccgtttttgggaggacctggttcttgccttggtgggtgaccaattggattatggg
gataacatatgtggtgcagtactaagcattcgtttcaacgaggatatattgagtgtctgg
aatcgcaatgcttcagaccatcaggctgtaatggctctgagagattcaatcaaacgtcac
ttaaagcttcctcacagctatgttatggagtacaagccccatgatgcctctctgcgagac
aattcatcttacaggaacacttggttgagaggctag

DBGET integrated database retrieval system