KEGG   Glycine max (soybean): 100817799Help
Entry
100817799         CDS       T01710                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
gmx  Glycine max (soybean)
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gmx00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 112 aa AA seqDB search
MASFDEAPPGNSKNGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTPGYSYSTA
NKNMAVIWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQERADLIAYLKESTA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccttcgatgaagctcctcccggaaactccaagaacggcgagaagatcttcaaa
accaagtgcgctcagtgccacaccgtcgacaaaggtgccggccacaaacaaggacccaat
ctgaatggtttgtttggaagacaatctggtacaactcctggatattcctattctactgct
aacaaaaacatggccgtgatttgggaggaaaagaccctctatgattacttgctcaacccc
aaaaagtatattccaggaacgaagatggtatttcctggtcttaagaaacctcaggaacgt
gcagatcttatcgcatatcttaaagaatctactgcttaa

DBGET integrated database retrieval system