KEGG   Glycine max (soybean): 100817924Help
Entry
100817924         CDS       T01710                                 

Definition
probable pectinesterase 53-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
gmx  Glycine max (soybean)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100817924
   00500 Starch and sucrose metabolism
    100817924
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     100817924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 381 aa AA seqDB search
MSNLHCMFILLAVLVLLLQNSSRIHCHTKGIRPRRSAGKVLSTNMTRVHYSEQQFMKWVN
FVGSLKHSVFKSAKNKLVASYTLHVDKNPNAGDFTSIQEAIDSLPFINLVRVVIKVHAGV
YTEKVNIPPLKSYITIEGADADKTIVKWGDTAQTPGSNGRPLGTYGSATFAVNSPYFLAK
NITFQNTTPVPAPGAVGKQAVALRISADTAAFVGCKFLGAQDTLYDHLGRHFYKDCYIEG
SVDFIFGNSLSLFEGCHVHAIAQNTGAVTAQGRSSMLEDTGFSFVNCKVTGSGALYLGRA
WGPFSRVVFAYTYMENIIIPKGWYNWGDPNREMTVFYGQYKCTGLGASFAGRVPWSRELT
DEEATPFLSLSFVDGTEWIKV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacttgcattgcatgttcatcttgttagcagttcttgttcttcttctgcaaaat
tccagcagaatacattgtcataccaagggaattagaccaagacgttctgcaggtaaagtg
ttatcgaccaacatgactagagtgcattattctgaacagcaattcatgaaatgggtgaat
tttgttggttccctcaaacactcagtttttaagtcagctaaaaataagcttgtggcttct
tacactttgcacgttgataagaatcctaatgctggagattttacctcaattcaagaagcc
attgattcccttccattcatcaatcttgtgagagtggtcattaaagtccatgcaggggtc
tacacggagaaagttaacattcctcctttgaaatcctacataacaatagaaggagctgat
gcagataaaaccattgttaaatggggtgacactgctcaaacacctggctcaaatgggagg
ccactaggaacctatggttcagcaacttttgctgtgaattcaccttatttccttgccaag
aacatcacattccaaaacacaactcctgttcctgcaccaggagcagttggaaagcaagcg
gttgcattaaggatttcagcagacacagcagcatttgtaggctgcaaattcttaggagca
caagacacactttatgatcatttgggcagacatttctataaggattgttacatcgaaggc
tctgttgatttcatatttggcaactctctctcactgtttgagggatgtcacgtgcatgcc
atagcacagaatacaggggccgtaacagctcaaggaaggagtagtatgttggaggacacg
gggttctcatttgtgaactgcaaggtcacgggatcaggggcactataccttggaagggct
tggggacccttttctcgcgtggtctttgcctacacatatatggaaaacatcatcattccc
aaaggctggtataactggggtgatcctaaccgtgaaatgactgtattctacgggcagtac
aaatgcacaggacttggagcaagctttgcagggagagtaccatggtcgagagagcttact
gacgaggaagctacaccttttctttcacttagctttgttgatggaaccgaatggatcaaa
gtgtag

DBGET integrated database retrieval system