KEGG   Glycine max (soybean): 100818013Help
Entry
100818013         CDS       T01710                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
gmx  Glycine max (soybean)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100818013
  Lipid metabolism
   00062 Fatty acid elongation
    100818013
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100818013
Lipid biosynthesis proteins [BR:gmx01004]
 Fatty acid synthase
  Component type
   100818013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 330 aa AA seqDB search
MPNVRLLFALALFFAGAQSVPFIVLHGIGDACKHSGIRNFIKELSKWSGSPGYCLEIGNG
SWDSWTKPLLKQTSIACEKVKKMSDLGQGYNIVGLSQGNLIGRGIIEFCDGAPPVKNFIS
LGGPHAGTASIPLCGSESLCTLIDVVLQLGIYSRFAQQNLAPSGYVKIPIDIAGYIRGCK
FLPKLNNEIVNKRNSTYRQRFASLQNLILIMFEQDTIVIPKETAWFGYYPNGALHPVVPV
QQTELYIDDWIGLRALDEAGKVKFVNVSGDHLDISRSDMKTYIVPYLTDEASIVPRPKLK
HSSGWISSIWSSLAEMFGLNEDLEVLSNDI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacgtcagactactgttcgcgcttgcgctattcttcgccggagcacaatctgtt
ccattcatcgttttgcatggtattggagatgcatgcaaacattcgggcattagaaacttt
attaaggaactaagcaagtggtctggttcaccaggatactgcttagaaattggaaatgga
tcctgggattcttggactaagcctctattaaaacagacatctattgcctgtgagaaggta
aagaagatgagtgatctaggtcagggttacaacattgtgggactttctcagggaaacttg
attggtagaggaataattgaattttgtgatggagcacctcctgttaagaattttatatcg
ctgggaggtccacatgctggtaccgcttctattccattatgtggatccgagtcattatgc
acccttattgatgttgtactccaattagggatctacagccggtttgcccagcaaaatctg
gctcccagtggctatgttaaaatacccatagatatagctggctacattaggggttgtaag
ttccttccaaagcttaataatgaaatagttaataagaggaattccacctacaggcagcga
tttgctagcttacagaatttgattctcataatgtttgaacaggatacaattgtaatacca
aaggaaacagcttggtttggctattatccaaatggagcccttcatcccgttgtaccagtt
caacagactgagctctacattgatgattggataggtttgagagctcttgacgaagctggg
aaagttaaatttgttaacgtatcaggagatcatctagatatctctcgcagtgacatgaaa
acttatatagtgccgtatttaactgatgaagcatcaattgttccaaggccaaaactaaaa
cattcttctggttggatttcttccatttggagctctctggcggaaatgtttggactcaac
gaagatttggaagttctttcaaatgatatttag

DBGET integrated database retrieval system