KEGG   Glycine max (soybean): 100818063Help
Entry
100818063         CDS       T01710                                 

Definition
beta-amylase 3, chloroplastic-like
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
gmx  Glycine max (soybean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gmx00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 547 aa AA seqDB search
MALTLRSSTSFINQKETKVLKTSDDIPATVSFSKFKPLVRLRAKNSMQEAHHTRENSFNE
ASRSEKWEKVLAPSVAHNHNDSKRVPVYVMLPLDTVTMEGRLNKPRAMNASLMALKSAGV
EGVMVDAWWGLVEKDGPLKYNWEPYAELVQMVQMHGLKLQVVMSFHQCGGNVGDNCSIPL
PPWVLEEISKNPELVYTDRSGRRNPEYISLGCDSVPVLRGRTPLQVYSDYMRSFRDRFRD
YLGSVIVEIQVGMGPCGELRYPSYPETNGTWRFPGIGEFQCYDKYMKASLAAAAEDIGKK
EWGGGGPHDSGQYNQFPEDTGFFKREGTWNTEYGQFFLEWYSGKLLEHGERILVSAKGIF
QTTGVKLSGKVAGIHWHYRARSHAAELTAGYYNTRHNDGYLPIARMLAKHGVVFNFTCME
MKDREQPDFAYCSPEGLVHQVKMATTTARAELAGENALERYDADAYAQVLSTSKSESGSG
LAAFTYLRMNKRLFEGDNWRHLVDFVRNMSEGGRRERLPAADSHGSDLYVGHIKATREKH
TQEAALV
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggctctaacacttcgttcttcaacttcttttattaatcagaaggaaaccaaagtcctt
aaaacttctgatgatatccctgcgacagttagtttttcaaaattcaagccattggtccgt
ctccgggcgaaaaattcaatgcaagaagcgcatcacactcgcgagaacagcttcaatgaa
gcaagtagaagcgagaaatgggagaaggtgcttgctccatcggttgcacataaccacaat
gattcgaagagagtacctgtgtatgtgatgctgccactggacacggtaacaatggaagga
agattgaacaagcctagagcaatgaatgcgagtttgatggccctgaagagtgcaggagtt
gaaggtgtaatggtggatgcttggtggggtttggtggagaaagatgggcctttgaagtac
aactgggagccatatgctgagcttgtacagatggtgcaaatgcatggtttgaagcttcaa
gttgttatgtctttccatcagtgtgggggcaatgttggagacaattgcagcattcctcta
ccaccatgggtgttggaagaaatcagcaagaaccctgagctggtttacacagacagatca
gggaggaggaatcctgagtacatctccttgggctgtgattcagttcctgttctaagagga
aggactcctctccaagtgtactctgactacatgagaagctttcgtgacagattcagagat
tacttgggcagtgttatcgtggaaatacaagtggggatgggtccttgtggagagctgaga
tatccttcttatccggaaaccaatggaacttggaggtttcccggaattggagaattccaa
tgttatgacaagtatatgaaagcatccttggcagcagcagccgaagacattggaaagaaa
gaatggggaggaggaggaccccatgactcaggccagtacaatcaatttcctgaggatact
ggatttttcaaaagggaaggaacatggaacactgaatatggacagttctttctggaatgg
tactctggtaaattgctggaacacggtgagaggatcctcgtatctgctaaaggaatattc
caaacaactggggtgaaactatcagggaaagttgctggaatccactggcattacagagca
aggtcacacgcagctgaactaactgctggctactataacacacgacataacgatggatat
ctgcctatagcaaggatgctggcaaaacatggagttgtcttcaatttcacctgcatggaa
atgaaggacagagagcagcctgactttgcatattgctcacctgaagggttagttcaccag
gtgaagatggcaacaacaacagctagagcagaacttgctggggaaaatgcattggagaga
tatgatgcagatgcatatgctcaagttttatcaacaagtaagtcggaatccggcagcgga
ttggctgcattcacatatctaagaatgaacaagaggttgtttgaaggtgataactggcgg
cacctagtggattttgtaagaaacatgtctgagggtggtcggagagagagacttccagca
gctgattcccatgggagtgatctttatgttgggcacatcaaagcaacacgggaaaagcac
acacaagaggctgctcttgtgtaa

DBGET integrated database retrieval system