KEGG   Glycine max (soybean): 100818152Help
Entry
100818152         CDS       T01710                                 

Definition
acyl-protein thioesterase 1-like
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
gmx  Glycine max (soybean)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100818152
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100818152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 253 aa AA seqDB search
MKLIKGSVVLTITITLSSAILLLLLFPQNQKPSSSSMSRARSFVLWLHGLGDSGPANEPI
KTLFTSSQFRDTKWSFPSAPSAPVTCNYGSVMPSWFDILEIPVAADSPNDESSLLKAVRN
VHATIDKEIAAGINPNNIFICGFSQGGALTLASVLLYPKTLGGGAVFSGWVPFNSSIIEQ
ITPEAKQTPILWSHGLVDRTVMFEAGQAGPPFLEKIGVGCEFKAYPGLGHTINNEELLYL
ESWIKARLQSSSQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgataaagggcagtgttgtgttaacaatcacaatcacattaagtagcgccatt
ctgttgctactattgttcccacaaaaccaaaagccatcttcttcttccatgtcgagggcg
cgaagctttgttctgtggcttcacggcctgggtgactctggtcccgccaacgaacccatc
aaaaccttattcacttcttcccaattcagagacaccaaatggtccttcccttctgcccct
tccgcccctgtcacttgcaactatggttctgtaatgccttcatggtttgacattcttgag
attcccgtggcagctgattctccaaatgacgagagtagtttacttaaagctgttcgaaat
gtgcatgctactatagacaaggaaatagctgctggcataaaccctaacaacatatttatc
tgtggattcagtcaaggaggtgccttgaccttggctagtgttctactgtaccctaaaact
ttaggtggaggtgcagtctttagtggttgggttccattcaattcatctattatagaacaa
attacaccagaggcaaagcagacacccatactatggtcccatgggctggttgatagaacg
gtaatgtttgaggccggacaagcaggtcccccgttccttgaaaaaattggtgtgggatgc
gagtttaaggcttatcctggtctaggccacacgataaacaatgaggagctgctgtatctc
gagtcgtggatcaaggcacgcctacaaagttcttcccaataa

DBGET integrated database retrieval system