KEGG   Glycine max (soybean): 100818755Help
Entry
100818755         CDS       T01710                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 6-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00030  Pentose phosphate pathway
gmx00051  Fructose and mannose metabolism
gmx00052  Galactose metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
gmx01230  Biosynthesis of amino acids
gmx03018  RNA degradation
Module
gmx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100818755
   00030 Pentose phosphate pathway
    100818755
   00051 Fructose and mannose metabolism
    100818755
   00052 Galactose metabolism
    100818755
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100818755
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100818755
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100818755
Messenger RNA biogenesis [BR:gmx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100818755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100818755
NCBI-ProteinID: XP_003522720
UniProt: I1JUY7
Position
4
AA seq 509 aa AA seqDB search
MPSNDSDSPMKIVHGDAGYILEDVPHFTDYIPNLPTYPNPLRSNPAYSVVKQYFVHMDDT
VPQKVVVHKDSPRGIHFRRAGPRQKVYFKSDEVHACIVTCGGLCPGLNTVIREIVCGLSY
MYGVNKVLGIDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDR
GINQVYIIGGDGTQRGATVIYEEVRRRGLKVAIAGIPKTIDNDIPVIDKSFGFDTAVEEA
QRAINAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGL
FEFIQKRLKENGHMVIVIAEGAGQDLLTESMQAMDQKDASGNKLLQDVGLWISHKIKDHF
ARKDKIPINLKYIDPTYMIRAIQSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHT
YIPFNRINERQNKVVITDRMWARLLSSTNQPSFLSPKDLEEAKKAEQPPTELLEGNNCND
VGDAGKEEQPPKDEQESGNHADNGIKTEN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaacgattccgattcgccgatgaagatcgtacatggcgacgctggttacata
ctcgaagacgttcctcacttcaccgactacattccaaatcttcctacgtatccgaatccg
cttcgatccaatcctgcttactcggttgttaagcagtatttcgtgcacatggacgacact
gttcctcagaaggttgttgttcacaaggatagtccaagaggtatacattttcgacgtgca
gggcctcggcaaaaggtatactttaaatcggatgaagtgcatgcatgcattgtcacgtgt
ggtggactctgccctggcctcaacactgtcataagggaaattgtctgtggtctttcctac
atgtacggtgttaacaaagtccttggcatagatggtggttatagaggcttttattccaaa
aacaccattactttaacacctaaggtggtcaatgacatccataagcgtgggggtacaatt
cttgggacatcccgaggggggcatgatacgggcaagatagttgacagcatccaggatcga
ggaattaatcaggtttatattattggaggagatggaacacagagaggagcgactgtgatt
tacgaggaagttagacggcggggtctgaaagtagcaattgctggaattcctaaaaccata
gacaatgacatcccggttattgacaaatcttttggttttgatactgcggttgaggaggct
caacgtgccattaatgcagctcatgttgaagctgaaagtattgagaatggtattggtgtt
gtaaagctaatggggcgttatagtggttttattgcaatgtatgccactcttgctagcaga
gacgtggactgttgcttgattccagagtcgcccttctaccttgaaggaaagggtggactt
tttgaatttattcagaaaaggctgaaagaaaatggacatatggtcatagtcatagctgag
ggagcaggacaagatcttcttacagaaagcatgcaagccatggatcagaaggatgcttct
ggaaacaaactacttcaagatgttggtttatggatatctcataagatcaaggatcacttt
gcaaggaaggataagattcccatcaatcttaaatatatagatccaacttacatgatccgg
gcaatccaaagcaatgcatcagataatgtctactgtacacttcttgctcagagtgcagtc
catggtgcaatggcagggtatactggatttacagttggactggtcaacggcagacatact
tatattccattcaatagaatcaatgagaggcagaacaaggttgtgattactgacagaatg
tgggcaagactcctttcttcaaccaaccagcctagctttttgagccccaaagatttagaa
gaagccaagaaagcagaacaacctccgactgaattgttggaaggaaacaattgcaatgat
gttggtgatgccgggaaagaagaacaacctcccaaagatgaacaagaatcaggaaatcac
gcagacaatggtatcaagacagaaaattag

DBGET integrated database retrieval system