KEGG   Glycine max (soybean): 100818764Help
Entry
100818764         CDS       T01710                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100818764
Transfer RNA biogenesis [BR:gmx03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100818764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 564 aa AA seqDB search
MAAAAVAEVRKAPRPGKGGYEAHGLSEEEARVRAIAEIVSSMVDLSHKGQNVDLNALKSA
ACRKYGLSRAPKLVEMIAALPDAERETLLPKLRAKPVRTASGIAVVAVMSKPHRCPHIAT
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQLKRLGHSVDK
VEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVAYSEHGATKCIGMTIETRP
DYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAH
MMPDLPNVGVERDMESFREFFESPMFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQ
LVDIIARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTR
EAGIQDIHHQIKPEEVELVRRDYMANEGWETFLSYEDTRQDILVGLLRLRKCGRNTTCPE
LMGKCSIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIACREHRSTKIAVISGV
GTRHYYRKLGYELEGPYMVKYLVK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagcggtggcggaggtgaggaaggccccacggccgggcaagggcgggtac
gaagcgcacggcctgagcgaggaggaggcgcgagtgcgcgccatcgcggagatcgtcagc
tccatggtggacctctctcacaaaggccagaacgtggacctcaacgcgctcaagtccgcg
gcgtgccgcaagtacgggctctcacgcgcgcccaagctcgtggagatgatcgcggcgctc
cccgacgccgagcgcgagacgctcctccccaagctccgcgccaagcccgtccgcaccgcc
tccggaatcgccgtcgtcgcggtcatgtcgaagccgcaccggtgcccgcacatcgccacc
accggcaacatctgcgtctactgccccgggggacctgactccgatttcgagtacagtact
cagtcttacactggttacgaaccaaccagcatgcgcgcaattcgtgcgaggtataatcca
tatgtccaagcgaggagcaggatagatcagcttaagcgtttgggtcatagtgtagacaag
gttgagtttatcttaatgggaggtaccttcatgtcacttccggctgattaccgtgattac
tttataagaaatcttcatgatgctttgtctggacacacatctgctaatgtggaagaggct
gtggcatactctgagcatggggcaaccaagtgtattggtatgacgattgaaacgaggcca
gattattgtcttgggcctcacttgcgccaaatgctttcttatggttgtacacgattggag
attggagtccaaagcacctatgaggacgttgctcgagacacaaatagaggacacactgtt
gctgctgtagcggattgtttttgcctggctaaagatgctggtttcaaggttgttgctcac
atgatgcctgaccttcctaatgttggtgttgaaagggacatggaaagtttccgggagttt
tttgagagccccatgtttagagcagatgggcttaaaatatatcctacacttgtaattcgt
ggaactgggctttatgagctctggaaaactggcaggtatagaaactatccacctgagcaa
cttgtggacattatagcaaggatccttgcaatggtacccccatggacacgtgtttataga
gttcagcgggatattcccatgcctctggttacctctggggttgagaaaggaaatctgagg
gagctagcattagctcgaatggatgacctgggattgaaatgtcgtgatgttcggaccaga
gaagctggaatccaggatattcaccaccaaattaagccagaagaggtggagcttgttcgg
cgtgattatatggcaaatgagggttgggaaacatttctatcatatgaagatacacggcag
gatatccttgttggtttgttgcgactgcgaaaatgtggccgcaacactacttgtccagag
cttatggggaagtgttctattgttcgtgaactccacgtttatggaactgctgtaccagtt
catggacgggatgctgacaagctacaacaccagggttatggcacacttttaatggaggag
gcagaacgtattgcttgcagagaacacagatcaacaaaaatagctgtaatttcaggggtt
ggcacacgccattattacaggaaactgggatatgagcttgaaggaccttacatggtgaaa
tatctagtgaaataa

DBGET integrated database retrieval system