KEGG   Glycine max (soybean): 100819116Help
Entry
100819116         CDS       T01710                                 

Definition
probable MYST-like histone acetyltransferase 1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
gmx  Glycine max (soybean)
Brite
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100819116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 434 aa AA seqDB search
MGSLEAPTAAENGSAPAAGNGKSPSVNGAEAALEPDASKRRRSSVLPLEVGTRVMCRWRD
NKYHPVKVIERRKVPNVIPNDYEYYVHYTEFNRRLDEWVKLDQLDLNSVEAVVDEKVEEK
GATGLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELGRYEIETWYFSP
FPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKN
KVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLAC
ILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLDILKKH
KGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKVLDRHLKAAGRGGLEV
DVSKLIWTPYKEQS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgggttcactcgaggccccaaccgccgcggaaaacggttccgctcccgccgccggcaac
ggaaaatccccctccgtcaacggcgcggaggcggcgctggagcccgacgcatcgaagcgg
cggagatcgtcggtgctcccactggaggtgggcacgcgcgtcatgtgccggtggagggac
aacaagtaccaccccgtcaaagtcatcgaacgccgcaaggttcccaacgtcatccccaac
gattacgagtactacgtccattacactgagttcaataggaggcttgatgagtgggtgaag
cttgaccagttggatcttaattcagtggaggctgttgttgatgagaaagtggaggagaag
ggtgcaacaggtttgaagatgactcgccaccaaaagaggaagattgatgagacacatgta
gagggacatgaggagcttgatgctgccagtttgcgagaacatgaggaatttaccaaagtg
aaaaatatagctactattgagcttggaagatatgagattgagacatggtacttctcccca
ttcccaccagaatacaatgactgtttgaagctgtacttttgtgagttttgcctcaatttc
atgaaacgcaaagaacagcttcagaggcatatgaggaaatgtgatcttaagcatccccct
ggtgatgagatatacagaagtggtacactgtcaatgtttgaggtcgatggcaaaaagaac
aaggtttatgggcagaatctttgttatttggccaagttatttcttgatcacaagaccctc
tattatgatgtagacctgtttctgttctatgttttatgtgaatgtgatgatcgaggttgt
cacatggttggctatttctccaaggaaaaacattctgaggaatcttacaatttggcatgt
atcctcaccctaccaccttaccaaaggaaaggctatggcaaatttctaattgcattctca
tatgagctgtccaaaaaagagggcaaagttggcacacctgaaagacctctttctgacctt
ggactgctaagctacagaggatattggaccagggttctcttagacattctgaagaagcat
aagggaaacatttctatcaaggaactgagtgatatgactgccattaaagctgaagacata
ttaaccactctgcagagcctagaattgattcaatacaggaaaggtcagcatgttatatgc
gcagatccgaaagtgttggatcgccatcttaaagctgctggcagagggggcctggaggtt
gatgttagcaaactgatctggactccttataaagaacaaagttga

DBGET integrated database retrieval system