KEGG   Glycine max (soybean): 100819222Help
Entry
100819222         CDS       T01710                                 

Definition
NADH-cytochrome b5 reductase-like protein-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
gmx  Glycine max (soybean)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100819222
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100819222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 319 aa AA seqDB search
MAALLRRFASATPIPSNSSHTNLRLPFTAIAAISGGVSFLFYHSSPNFAHSQEAEQVESK
NIALVPDKWVEFKLQDTARVSHNTQLFRFSFDPTQKLGLDIASCILTRAPLGQDAEGKPK
FVIRPYTPISDPESNGYFDLLIKVYPEGKMSQHFASLKPGDVVEVKGPIEKLRYTPNMKK
HIGMIAGGTGITPMLQVIEAILRNPDDKTQISLLYANVSPDDILLKQKLDILATSHPNLK
IFYTVDNPTKNWRGGAGYISKDVVVKGLPSPSDDTLILVCGPPGMMKAISGEKAKDWTQG
EVSGILKEAGYTEQMVYKF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctcttgaggaggtttgcgagcgccactccgatcccatccaattcctctcac
accaatctccgccttcccttcaccgccatcgccgccatttccggcggagtctccttcctt
ttctaccattcctctcccaacttcgctcattcacaagaagcagaacaagtggaaagtaaa
aacatcgcactcgttccggataaatgggtcgagtttaagttgcaggatactgctagggtt
agtcacaatacccagctattcaggttttcatttgatcccactcagaaattgggtctggat
attgcttcttgcatccttacaagggctccattgggacaagatgctgaaggaaaaccaaaa
tttgtcatacgcccgtacactcctatttcagatccagaatcaaatggctattttgatttg
ctaatcaaggtatatcctgaagggaaaatgagccagcattttgcaagcttaaaaccgggt
gatgttgttgaagtgaaagggcccattgaaaagctcagatatactcctaatatgaagaag
catattggcatgattgctggaggcacaggaattactcctatgcttcaggtaattgaagct
atattgaggaatcctgatgacaaaactcagatatctttactttatgctaatgtctccccg
gatgacatactgcttaaacaaaagcttgacattcttgcaacaagccacccaaacttaaag
atattctacactgtagataatccaacgaaaaattggagaggaggtgcaggttacatatca
aaggatgtggttgtgaaaggcttacccagtcctagtgatgatactctaatacttgtgtgt
ggacccccgggtatgatgaaagcaatatctggagaaaaggccaaggactggacacaagga
gaggtttctggcatcctaaaagaggctggatacactgaacaaatggtatacaaattctga

DBGET integrated database retrieval system