KEGG   Glycine max (soybean): 100819240Help
Entry
100819240         CDS       T01710                                 

Definition
(RefSeq) rae1-like protein At1g80670-like
  KO
K14298  mRNA export factor
Organism
gmx  Glycine max (soybean)
Pathway
gmx03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100819240
Messenger RNA biogenesis [BR:gmx03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100819240
Chromosome and associated proteins [BR:gmx03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100819240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 100819240
NCBI-ProteinID: NP_001242030
UniProt: C6TCY4
Position
2
AA seq 347 aa AA seqDB search
MSTFGAAANTNPNKSYEVAQPPSDSISSICFSPKANFLVATSWDNQVRCWEITRNGTVVN
STPKASISHDQPVLCSAWKDDGTTVFSGGCDKQVKMWPLMSGGQPMTVAMHDAPVKDIAW
ISEMNLLATGSWDKTLKYWDTRQSNPVHTQQLPDRCYAITVKHPLMVVGTADRNLIVFNL
QNPQTEYKRIVSPLKYQTRSVAAFPDQQGFLVGSIEGRVGVHHLDDAQQNKNFTFKCHRE
NNEIYSVNSLNFHPVHHTFATAGSDGAFNFWDKDSKQRLKAMQRCSQPIPCSTFNNDGSI
FAYAVCYDWSKGAENHNPATAKNYIYLHLPQESEVKGKPRAGATGRK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccttcggagccgccgcgaatacgaatcccaacaaatcctacgaggtagcccaa
ccaccctctgattcaatttcgagtatttgtttcagtcccaaagccaatttcctcgtcgct
acttcatgggacaaccaggttcggtgttgggagataacaaggaatgggactgttgtcaac
agcactcccaaggcttccatttctcacgaccaaccggttttgtgctccgcttggaaggac
gatggaacgacagttttttctgggggctgtgacaagcaggtcaagatgtggcctcttatg
tctggtgggcagccaatgactgttgcgatgcacgatgctccagtgaaagacattgcatgg
atatcagaaatgaatcttttagccacgggaagttgggacaagaccctgaagtattgggat
actcggcagtcaaatccagtgcatactcaacaacttcctgatcgttgttatgcaataaca
gtgaaacatcctctgatggtagtgggaactgctgatagaaatctgattgtcttcaacctg
caaaatcctcagactgaatacaagagaatcgtatctcccctgaaatatcagaccagatct
gttgctgcttttccagatcaacaaggttttttggttggctcaatagaaggaagggttggg
gtacatcacctggatgatgcgcagcaaaacaagaactttacttttaaatgccacagagag
aacaatgagatatattcagtcaactccttaaatttccatccggtacatcacacttttgca
actgctggatctgatggtgcttttaatttctgggataaggacagtaaacagagactcaag
gctatgcaaaggtgtagtcagcccataccttgcagtacatttaataatgatggctccata
tttgcttatgcggtttgttatgattggagcaaaggtgcagaaaatcacaatccagctaca
gcaaagaactacatatatttgcacttaccacaggagtctgaggttaaaggcaagccacga
gctggagcaacaggtagaaagtga

DBGET integrated database retrieval system