KEGG   Glycine max (soybean): 100819526Help
Entry
100819526         CDS       T01710                                 

Definition
probable 26S proteasome non-ATPase regulatory subunit 3-like
Orthology
K03033  
26S proteasome regulatory subunit N3
Organism
gmx  Glycine max (soybean)
Pathway
Proteasome
Class
Genetic Information Processing; Folding, sorting and degradation; Proteasome [PATH:gmx03050]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 490 aa AA seqDB search
MSEDEEMKDQATPSHLLSSVPPSTLHHLKGIASIIETGSYSKEVRRIARALRLTFAFRRK
LTTPVLSSFLDYVLTPASEPHTRLSSYLPNPKEGDREMEVDSATSTIQTLAAKHLLPELE
IYCYLLVLLFLIDQKRYDAAKACSSASIVRLKSLNRRTVDVIASRLYFYYSYSYELTGNL
AEIRGNLLALHRIATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQ
FCRYLFYLGKIRTIQLEYTDAKESLLQAARKAPSAAQGFRIQCNKWAVIVRLLLGEIPER
TVFMQRGMEKALRPYFELTNAVRIGDLELFRNVAEKFGTTFNRDRTHNLIVRLRHNVIRT
GLRNISISYSRISLVDVAKKLRLNSASPVADAESIVAKAIRDGAIDASLDHANGWMVSKE
TGDIYSTNEPQLAFNSRIAFCLNMHNEAVRALRFPPNTQKEKESAEKRRERHQQEQELAK
HIAEEDDDDF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagacgaggagatgaaagatcaggcaacgccttcacacttgctttcttcagtt
cctccatctacattgcaccatttgaagggaatagcatcaattattgaaaccggttcgtac
tcaaaggaagttcgtcgaattgctcgtgccctgcgccttacatttgcatttaggcgtaaa
ttgacaacaccagttctctcatcttttcttgattatgttcttactcccgcttctgaacct
cacactaggttatcctcttatctccctaatcctaaggagggtgatcgagagatggaagtg
gacagtgcaacatctactattcaaaccctggcggcgaagcacttgttgcctgagctagaa
atctactgttacctccttgtccttctttttctgattgaccagaaaagatacgatgcggcc
aaagcttgttcctcagcaagcattgttcggctgaagagcctgaatagaagaactgtcgat
gttattgcatctagactgtacttttattactcatatagctatgagcttacaggaaatctt
gctgaaattcgaggcaacctccttgcattgcaccggattgctaccctgcgtcatgatgag
ctgggtcaggaaacccttctgaatctgttacttcgtaactatctacattacaacctatat
gatcaggcagagaagttgaggtccaaggctccacgttttgaggcacattcaaaccagcag
ttctgtcgttatctcttctaccttgggaaaattcggacaattcagttggagtacacagat
gcaaaagagtcactcttgcaggctgctcgtaaagctcccagtgcagcacagggttttcgg
attcaatgtaacaagtgggctgtgatagtgcgtttattattgggagaaatacctgagagg
accgtctttatgcagagaggaatggagaaagctttgaggccttactttgagcttactaat
gctgtccggattggtgacttggagctatttaggaatgttgcagagaagtttggtactact
ttcaatagagaccgaactcataatttgattgttcggctccgtcataatgtcatccggact
ggtttacgcaacatcagcatatcatattcacgcatctcgctagttgatgtagctaaaaag
ttgaggttgaactctgcaagtcctgttgctgacgctgagagcattgtagcaaaggctatc
cgtgatggggctattgatgcttcattggatcatgccaatgggtggatggtatccaaggaa
actggagatatctactctacaaatgagcctcagttggcatttaattctcggattgccttt
tgtcttaacatgcacaatgaggcagttcgagcactgcgttttccaccaaacacacagaag
gaaaaggaaagtgctgagaagaggagagagaggcatcaacaagagcaagaattggctaaa
catatcgcagaggaagatgatgatgacttttga

DBGET integrated database retrieval system