KEGG   Glycine max (soybean): 100819896Help
Entry
100819896         CDS       T01710                                 

Definition
(RefSeq) alcohol dehydrogenase-like 4
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00071  Fatty acid degradation
gmx00350  Tyrosine metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100819896
  Lipid metabolism
   00071 Fatty acid degradation
    100819896
  Amino acid metabolism
   00350 Tyrosine metabolism
    100819896
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100819896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C UDPG_MGDP_dh_N TrkA_N AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 100819896
NCBI-ProteinID: XP_003530282
UniProt: I1KKE1
Position
7
AA seq 400 aa AA seqDB search
MACPAMANGNGSLKNLKLNDTKGKTITCKAAVVYGPGEPFVVENILVHPPQKMEVRIKIL
YTSICHTDLSAWRGVNEAQRAYPRIFGHEASGIVESVGEGVSEVEEGDIVVPIFNGECGE
CSMCKCEKTNLCERFGVDATKKVMEGDGTTRFSTVNGKPIFHFLNTSTFSEYTVVDSACV
VKFLDSDHSLSHKNLTLLSCGVSTGVGGAWNTANVHSGSTVAIFGLGVVGLAVAEGARAR
GASKIIGVDINPDKFIKAQTMGVTDFINPDDEEKPVYERIREITDGGVHYSFECTGNVDV
LRDAFLSSHEGWGLTVILGVHASPKLLPIHPMELLDGRNIVGCVFGGFKGRSQLPHFAKE
CGQGVVKLDNFITHELPFEEIDKAFDLLITGKSLRCLLHF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcatgtccagcaatggcaaatgggaacggctcattgaagaacttgaagctaaatgac
accaagggaaagaccatcacttgcaaagctgccgtggtatatggtcctggagagcccttt
gtggtggaaaacattcttgttcatcctcctcagaaaatggaggttcgaatcaagatcctc
tacacttccatttgtcacaccgatcttagcgcatggcgaggcgtgaacgaggctcaacgt
gcttatcctcggatttttggccatgaagcatctgggattgtggagagtgtaggggaagga
gtgagtgaagttgaggaaggggacatagtagtgccaatattcaatggggagtgtggagag
tgttcgatgtgcaagtgtgagaagaccaacttgtgtgagaggtttggggtggatgccacg
aagaaggtgatggaaggagatggcacaacaagattctccactgttaatgggaaacccatt
ttccatttcttgaacacttcaactttctcggagtacacggtggtggattcggcctgtgtg
gtgaagtttctggactccgatcacagtctcagccacaagaacctcaccttgctcagctgt
ggcgtctccacaggggttggaggcgcttggaatacagctaatgtgcattctggttcaact
gtagctattttcggcttaggagttgttgggctcgctgttgctgagggggcacgagctaga
ggtgcatccaaaataattggcgtagacatcaatcctgacaaattcatcaaagcccaaact
atgggagtgacagacttcataaaccctgatgatgaagagaagccagtatacgagagaatt
agagaaataactgatggaggtgtacactacagttttgaatgtactggaaacgtggacgtt
ttaagggatgccttcttgtcatcccatgagggttggggattgactgtaatattgggagtt
catgcgtcaccaaagttgcttcccatccacccaatggagctcttagacggtcgcaacatt
gtaggatgtgtatttggaggtttcaaagggagaagtcaattgcctcactttgccaaagaa
tgtggacaaggagtggtgaagctggataatttcatcactcacgagctaccctttgaggag
atagacaaagccttcgatcttttgatcactgggaagtcactgagatgccttctgcacttc
taa

DBGET integrated database retrieval system